Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66240 120 / 7e-36 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT3G56240 111 / 3e-32 ATX1, CCH copper chaperone (.1) AT5G27690 69 / 4e-14 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 64 / 3e-13 Heavy metal transport/detoxification superfamily protein (.1) AT5G02600 66 / 4e-13 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT2G37390 65 / 4e-13 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT1G71050 63 / 6e-13 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 63 / 8e-13 Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 62 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 61 / 3e-12 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043444 [exp] 118 / 1e-34 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3) Lus10034138 [exp] 102 / 4e-27 AT1G66240 115 / 1e-32 homolog of anti-oxidant 1 (.1.2.3) Lus10008963 [exp] 84 / 2e-20 AT1G66240 81 / 5e-20 homolog of anti-oxidant 1 (.1.2.3) Lus10024435 [exp] 72 / 2e-15 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10025294 [exp] 71 / 4e-15 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10042946 [exp] 65 / 1e-13 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10039419 [exp] 65 / 1e-13 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1) Lus10013911 [exp] 65 / 2e-13 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) Lus10032446 [exp] 64 / 3e-13 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G236500 [exp] 117 / 4e-35 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.008G023800 [exp] 113 / 3e-33 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3) Potri.006G024800 [exp] 73 / 9e-17 AT3G56891 167 / 5e-54 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 71 / 3e-16 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 69 / 2e-15 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 67 / 2e-14 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 67 / 2e-14 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.016G080400 [exp] 66 / 3e-13 AT2G37390 133 / 2e-37 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.006G213900 [exp] 66 / 4e-13 AT2G37390 127 / 2e-35 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.019G106500 [exp] 62 / 1e-12 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10028859 pacid=23177333 polypeptide=Lus10028859 locus=Lus10028859.g ID=Lus10028859.BGIv1.0 annot-version=v1.0 ATGTCTCAGGTATCAATCCCTCCGCCTCACCCGTCAATTCCGTCGCTTCTGCTTGATTGTTTTGCGTTATGTTGTCGACCCACAAATCGTCGTTCTCGTT TTCGCCTTCTGATCTGGATCTCCGATGGTCAAAGCTCGGAGATTGGTTATGTTAGGGATGGATCCATTTCTGGGTTTGTTGGGTACTGGATTCTTAAAGT TTCTGTAATCTTTTCCATTGTTGGATTGCATAAAGGTTGGTCAAAGACTGTTGTCCTCAAGGTAGCCATGTCCTGCGAGGGATGCTCTGGAGCTGTGAAA AGGGTCTTGACTAAAATGGAAGGTGTGGAGTCTTTTGACATTGACATGAAGGAACAGAAAGTCACGGTGAAAGGAAACGTCAAGCCAGAGGCGGTGCTCC AGACTGTGTCAAAGACTGGGAAGAAAACTGCATTCTGGGAAGGAGGAGAAGCAGCTGGTGCTGCAACCGAAGTCAAGCCCACCGAGTCTTAG
AA sequence Show only first row Show all	>Lus10028859 pacid=23177333 polypeptide=Lus10028859 locus=Lus10028859.g ID=Lus10028859.BGIv1.0 annot-version=v1.0 MSQVSIPPPHPSIPSLLLDCFALCCRPTNRRSRFRLLIWISDGQSSEIGYVRDGSISGFVGYWILKVSVIFSIVGLHKGWSKTVVLKVAMSCEGCSGAVK RVLTKMEGVESFDIDMKEQKVTVKGNVKPEAVLQTVSKTGKKTAFWEGGEAAGAATEVKPTES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Lus10028859 [exp]	0	1
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10017822 [exp]	1.4	0.9027
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10041539 [exp]	2.2	0.8935
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10002264 [exp]	2.4	0.9027
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030906 [exp]	3.9	0.9003
AT2G27490		ATCOAE	dephospho-CoA kinase family (....		Lus10013897 [exp]	4.5	0.8974
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Lus10022253 [exp]	4.9	0.8884
AT1G27000			Protein of unknown function (D...		Lus10037210 [exp]	5.7	0.8702
AT5G09260		VPS20.2	vacuolar protein sorting-assoc...		Lus10037699 [exp]	7.3	0.8923
AT4G08230			glycine-rich protein (.1.2)		Lus10024100 [exp]	8.1	0.8739
AT5G58920			unknown protein		Lus10040699 [exp]	8.1	0.8630

Compare expression of checked genes

Lus10028859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.