Lus10028878 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04910 126 / 5e-37 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008941 168 / 2e-53 AT5G04910 248 / 7e-84 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G012100 137 / 3e-41 AT5G04910 245 / 8e-83 unknown protein
PFAM info
Representative CDS sequence
>Lus10028878 pacid=23177173 polypeptide=Lus10028878 locus=Lus10028878.g ID=Lus10028878.BGIv1.0 annot-version=v1.0
ATGCCATGGACAAAAGTGAAGGAGCACAACGGGAGAGTAGATAGGCGGAGGTTTTTCAAAGGGTTTTTGGATGCAGACACTGAGGAGGAGCGAAGGAGGT
TGATTTTGGGTTTACGCGCCCGTCTTGTCCTGGAAATTGAGGCACTATTTCTGGACCCTGATTACAGCCGATCTGATCTAGCACAATTGCTCAGAGCTGT
TCAAACACAGGAAAAGCTGAAATTACAGCTGACTGCAACGATCCACCTATTGAAGAAAGCTGGTCGGCCGTCTGAGCGCCTGGTGAGCCATGCAAATTGC
AGGTTTAACAAGCCTATGGAACACCAGTGCGTCCACTTGCACGAAATAACAGAGGAAGAAGGGACCGAAGAAGCAGAAGCGAATGCAGAATACGACCATG
CCCTCAATGAAGCCATTAGAGGAGTGCAAGATGCAGTTCACTAA
AA sequence
>Lus10028878 pacid=23177173 polypeptide=Lus10028878 locus=Lus10028878.g ID=Lus10028878.BGIv1.0 annot-version=v1.0
MPWTKVKEHNGRVDRRRFFKGFLDADTEEERRRLILGLRARLVLEIEALFLDPDYSRSDLAQLLRAVQTQEKLKLQLTATIHLLKKAGRPSERLVSHANC
RFNKPMEHQCVHLHEITEEEGTEEAEANAEYDHALNEAIRGVQDAVH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G04910 unknown protein Lus10028878 0 1
AT5G26749 C2H2 and C2HC zinc fingers sup... Lus10031439 1.4 0.9296
AT3G23770 O-Glycosyl hydrolases family 1... Lus10023226 2.4 0.9365
AT2G39210 Major facilitator superfamily ... Lus10021513 5.4 0.8568
AT3G26040 HXXXD-type acyl-transferase fa... Lus10042994 10.5 0.8641
AT5G24318 O-Glycosyl hydrolases family 1... Lus10008865 13.0 0.8705
AT1G10800 unknown protein Lus10037441 15.3 0.9020
Lus10039025 15.5 0.8890
AT1G15360 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integr... Lus10009480 15.6 0.8796
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10037262 16.2 0.8785
AT2G31730 bHLH basic helix-loop-helix (bHLH) ... Lus10041649 16.3 0.8968

Lus10028878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.