Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01520 128 / 1e-38 ZCE1, MLP328 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1) AT2G01530 125 / 2e-37 ZCE2, MLP329 \(Zusammen-CA\)-enhanced 2, MLP-like protein 329 (.1) AT5G28010 123 / 3e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14950 120 / 2e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G14060 120 / 3e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14960 119 / 6e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT3G26450 118 / 2e-34 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14940 116 / 1e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) AT3G26460 115 / 2e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 115 / 3e-33 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008930 [exp] 299 / 5e-106 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10033397 [exp] 225 / 1e-76 AT1G14950 121 / 1e-35 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008932 [exp] 226 / 1e-75 AT4G14060 127 / 1e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042489 [exp] 140 / 3e-43 AT1G14960 104 / 5e-29 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10042490 [exp] 138 / 3e-42 AT1G14930 107 / 3e-30 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10008931 [exp] 100 / 3e-28 AT1G70870 59 / 6e-13 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10020497 [exp] 82 / 5e-20 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1) Lus10020498 [exp] 81 / 2e-19 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012466 [exp] 77 / 3e-18 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131100 [exp] 168 / 3e-54 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1) Potri.008G131200 [exp] 164 / 2e-52 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131300 [exp] 141 / 1e-43 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.017G051100 [exp] 89 / 4e-23 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.010G111000 [exp] 88 / 1e-22 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.017G051200 [exp] 69 / 1e-15 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.004G032900 [exp] 58 / 4e-11 AT1G24020 59 / 2e-11 MLP-like protein 423 (.1.2) Potri.004G033000 [exp] 57 / 2e-10 AT1G24020 57 / 1e-10 MLP-like protein 423 (.1.2) Potri.013G131000 [exp] 39 / 0.0004 AT1G24020 62 / 1e-12 MLP-like protein 423 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10028887 pacid=23177101 polypeptide=Lus10028887 locus=Lus10028887.g ID=Lus10028887.BGIv1.0 annot-version=v1.0 ATGGCGGCTACATCAGAGATGAGCGGGAAGCTGGAGGCGGAGGTGGAGCTGAAAGCTCCGCCGGCGAAGTTCTTTAACGTGTTCAGGGAAGCAGCTCATC ACATCCCAAAGCACACTCCTTCCAACATTCAGGCAGTCGAGTGCCACCACGGTGACTGGGAAAGTCACGACGGCATCAAGATCTGGAACTACACCTGTGA GGGGAAGGCGGAGGTGTTCAAGGAGAGGGTGGAGTTCGACGAGCAGAATAAGATCGTGAAATTGAATGGTTTAGAAGGAGATGTGATGAAGATATACAAA GTGTACAACCCGATTTTCGAGTTCATCACCAAAAGTGAAGGGGGCGGGGTGGTAAAGCTGAGCATCGAGTACGAGAAGCTGGACCCGAGTTTCCCACCTC CAACCAAGTACATGGATTTCATGATCGACCTTACTAAGGAGACTGATGCCGGCCTTGTCAAAGCCGGTTGA
AA sequence Show only first row Show all	>Lus10028887 pacid=23177101 polypeptide=Lus10028887 locus=Lus10028887.g ID=Lus10028887.BGIv1.0 annot-version=v1.0 MAATSEMSGKLEAEVELKAPPAKFFNVFREAAHHIPKHTPSNIQAVECHHGDWESHDGIKIWNYTCEGKAEVFKERVEFDEQNKIVKLNGLEGDVMKIYK VYNPIFEFITKSEGGGVVKLSIEYEKLDPSFPPPTKYMDFMIDLTKETDAGLVKAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G01520		ZCE1, MLP328	\(Zusammen-CA\)-enhanced 1, ML...		Lus10028887 [exp]	0	1
AT3G18420			Protein prenylyltransferase su...		Lus10035087 [exp]	2.4	0.8821
AT5G12300			Calcium-dependent lipid-bindin...		Lus10001346 [exp]	2.8	0.8892
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Lus10005447 [exp]	5.2	0.8652
AT1G56260		MDO1	MERISTEM DISORGANIZATION 1, un...		Lus10020669 [exp]	6.1	0.8943
AT2G40200	bHLH	bHLH051	basic helix-loop-helix (bHLH) ...		Lus10007502 [exp]	11.0	0.8589
AT1G67710	GARP	ARR11	response regulator 11 (.1)		Lus10011389 [exp]	11.2	0.8188
AT5G22580			Stress responsive A/B Barrel D...		Lus10009407 [exp]	11.8	0.8775
AT2G38510			MATE efflux family protein (.1...		Lus10025156 [exp]	12.0	0.8566
AT5G35732			unknown protein		Lus10001730 [exp]	13.1	0.8790
AT1G14690		MAP65-7	microtubule-associated protein...		Lus10035098 [exp]	14.3	0.8534

Compare expression of checked genes

Lus10028887 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.