Lus10028900 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22850 216 / 9e-69 SNARE associated Golgi protein family (.1.2)
AT1G12450 216 / 1e-68 SNARE associated Golgi protein family (.1)
AT4G12000 200 / 1e-62 SNARE associated Golgi protein family (.1)
AT2G02370 162 / 1e-47 SNARE associated Golgi protein family (.1.2)
AT1G22850 53 / 9e-08 SNARE associated Golgi protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008915 382 / 7e-134 AT1G12450 338 / 5e-117 SNARE associated Golgi protein family (.1)
Lus10007018 306 / 5e-104 AT1G12450 364 / 6e-127 SNARE associated Golgi protein family (.1)
Lus10006674 304 / 4e-103 AT1G12450 365 / 4e-127 SNARE associated Golgi protein family (.1)
Lus10012163 155 / 4e-45 AT2G02370 401 / 4e-141 SNARE associated Golgi protein family (.1.2)
Lus10007583 132 / 3e-36 AT2G02370 399 / 2e-140 SNARE associated Golgi protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G117400 256 / 2e-84 AT1G12450 343 / 1e-118 SNARE associated Golgi protein family (.1)
Potri.001G114600 254 / 8e-84 AT1G12450 317 / 3e-108 SNARE associated Golgi protein family (.1)
Potri.001G078700 152 / 7e-44 AT2G02370 390 / 2e-136 SNARE associated Golgi protein family (.1.2)
Potri.003G151800 145 / 3e-41 AT2G02370 377 / 2e-131 SNARE associated Golgi protein family (.1.2)
Potri.013G099600 52 / 1e-07 AT1G22850 305 / 6e-102 SNARE associated Golgi protein family (.1)
Potri.019G071900 52 / 2e-07 AT1G22850 330 / 8e-113 SNARE associated Golgi protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Lus10028900 pacid=23177341 polypeptide=Lus10028900 locus=Lus10028900.g ID=Lus10028900.BGIv1.0 annot-version=v1.0
ATGACGTATAGAAATGAAGATGACAGCTTGGTCTCTGAGCTGAGGATGAGAGTGGATGACGATGATGATGTTGATAAGAGCGGGTACATGAGATTGAGAG
GGGACGATGCTGATGCTGATGAAGAAGAAGGGTTTCTTGAGAAACCAGGGTGTAGTTTCTTCTGCTGGAAGTTGAGATGGTGTGTTGTTTGGTATTGGGT
CAGGCTCGTAACTCTGTTGGCTGTTGTGGGTGGTGTGGCTTTCGTTGTTTTCAGATGGGTTGGCCCCTTCTTCATCGAAAACGAAATTATTCCTATTATA
AACTGGGAGAAATCAACGTTTACTACTCCACAGCTAGGGCTACTGGTCTTCCTGTCAGTTGCATTATTCCCAATCCTGCTCCTTCCATCTTCTCCTTCAA
TGTGGATAGCTGGGATGACTTTTGGCTATGGATACGGATTCTTATTGATCACCGTCGCCTTGGCAGTTGGAATCTCACTTCCATTTTGTATTGGAAATCT
GTTCCTGCATAAAATTCGGGTGCAGTTAGAGAAGTATCCAAAGCAGGCTGCCATACTGAGAGCAGCAGGTGAAGGAAATTGGTTCCATCAGTTTCGTGCA
GTGGCGCTTATAAGAATTTCGCCATTTCCTTACGTCCTGTATAATTACTGTGCCGTTGCAACTCATGTCAAGTATGGCCCTTATCTGCTAGGGTCGTTGG
TGGGTACGGCGCCAGACACTTTTTTGACACTCTATACTGGGATCATCATATTGACCCTGGCAGATGCTTCAAAAGAACATCACAATCTCTCAGCCCCACA
GATCGCCTTCAATGTCATTGGTTTCTGTTGCACAGCAACTACCGCAGTGTTTTTCACTCTCTACGCTAAGAGACGGCTCAAAACACTGCCAGAGGAACCT
CTGTTATCGTAG
AA sequence
>Lus10028900 pacid=23177341 polypeptide=Lus10028900 locus=Lus10028900.g ID=Lus10028900.BGIv1.0 annot-version=v1.0
MTYRNEDDSLVSELRMRVDDDDDVDKSGYMRLRGDDADADEEEGFLEKPGCSFFCWKLRWCVVWYWVRLVTLLAVVGGVAFVVFRWVGPFFIENEIIPII
NWEKSTFTTPQLGLLVFLSVALFPILLLPSSPSMWIAGMTFGYGYGFLLITVALAVGISLPFCIGNLFLHKIRVQLEKYPKQAAILRAAGEGNWFHQFRA
VALIRISPFPYVLYNYCAVATHVKYGPYLLGSLVGTAPDTFLTLYTGIIILTLADASKEHHNLSAPQIAFNVIGFCCTATTAVFFTLYAKRRLKTLPEEP
LLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G12450 SNARE associated Golgi protein... Lus10028900 0 1
AT5G64500 Major facilitator superfamily ... Lus10011580 1.0 0.8899
AT2G25290 Phox1 Phox1, Octicosapeptide/Phox/Be... Lus10008035 2.4 0.8460
AT2G28320 Pleckstrin homology (PH) and l... Lus10016094 2.8 0.8480
AT4G29950 Ypt/Rab-GAP domain of gyp1p su... Lus10001628 6.0 0.7929
AT1G64610 Transducin/WD40 repeat-like su... Lus10003206 7.1 0.8150
AT3G05710 ATSYP43, SYP43 syntaxin of plants 43 (.1.2) Lus10031466 7.7 0.7528
AT1G08420 BSL2 BRI1 suppressor 1 (BSU1)-like ... Lus10004100 8.2 0.8415
AT3G05345 Chaperone DnaJ-domain superfam... Lus10000158 8.7 0.7980
AT5G06140 ATSNX1 ARABIDOPSIS THALIANA SORTING N... Lus10016994 8.7 0.7894
AT5G01990 Auxin efflux carrier family pr... Lus10035610 11.0 0.8043

Lus10028900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.