Lus10028906 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G12390 207 / 2e-70 Cornichon family protein (.1)
AT1G62880 184 / 6e-61 Cornichon family protein (.1.2)
AT1G12340 176 / 9e-58 Cornichon family protein (.1)
AT4G12090 165 / 1e-53 Cornichon family protein (.1)
AT3G12180 127 / 1e-38 Cornichon family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004320 233 / 2e-79 AT1G12390 173 / 1e-55 Cornichon family protein (.1)
Lus10007000 213 / 4e-72 AT1G12390 176 / 3e-57 Cornichon family protein (.1)
Lus10006997 213 / 4e-72 AT1G12390 176 / 3e-57 Cornichon family protein (.1)
Lus10000384 172 / 5e-56 AT1G12390 161 / 5e-52 Cornichon family protein (.1)
Lus10009295 145 / 1e-45 AT1G12390 142 / 7e-45 Cornichon family protein (.1)
Lus10015866 127 / 4e-39 AT1G12390 128 / 1e-39 Cornichon family protein (.1)
Lus10030270 103 / 2e-29 AT1G12390 94 / 2e-26 Cornichon family protein (.1)
Lus10004023 0 / 1 AT1G12340 101 / 5e-30 Cornichon family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G116100 239 / 5e-83 AT1G12390 184 / 3e-61 Cornichon family protein (.1)
Potri.003G116400 228 / 2e-78 AT1G12390 182 / 2e-60 Cornichon family protein (.1)
Potri.002G148500 100 / 3e-28 AT1G12390 106 / 9e-31 Cornichon family protein (.1)
Potri.016G051000 97 / 2e-26 AT3G12180 142 / 4e-44 Cornichon family protein (.1)
Potri.006G057300 97 / 3e-26 AT3G12180 109 / 3e-31 Cornichon family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03311 Cornichon Cornichon protein
Representative CDS sequence
>Lus10028906 pacid=23177156 polypeptide=Lus10028906 locus=Lus10028906.g ID=Lus10028906.BGIv1.0 annot-version=v1.0
ATGGGAGATCTATACGTATGGCTAATCTCCTTCTTTTTCCTTATTGCCCTACTCGTCATCATCGTCTTCCAGCTGATGTGCTTGGCAGATTTGGAGTTCG
ATTACATCAATCCATATGACTCTTCATCGAGGGTAAACAAAGTGATTTTGCCAGAGTATATCACGGAAGGAGCTTTGTGCTTGTTTTACCTTCTCACAGG
GCATTGGTGTATGGCTCTCTTGTGTGCTCCTTACCTCTACTACAACGTCAGGCTATACACTCGAAAACAACATCTGATAGATGTTACTGAGGTTTTCAAC
TTGCTCCATGCCGAAAAGAAGCAGCGGCTCTATAAATTGTTCTACCTCATCGTCCTCCTTTTTCTAGCAATATTCTGGATGATCTTGACGGCATTGGAAG
ATCACGACATGGACTGA
AA sequence
>Lus10028906 pacid=23177156 polypeptide=Lus10028906 locus=Lus10028906.g ID=Lus10028906.BGIv1.0 annot-version=v1.0
MGDLYVWLISFFFLIALLVIIVFQLMCLADLEFDYINPYDSSSRVNKVILPEYITEGALCLFYLLTGHWCMALLCAPYLYYNVRLYTRKQHLIDVTEVFN
LLHAEKKQRLYKLFYLIVLLFLAIFWMILTALEDHDMD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G12390 Cornichon family protein (.1) Lus10028906 0 1
AT3G46010 ATADF1, ADF1 actin depolymerizing factor 1 ... Lus10024417 1.7 0.8980
AT2G18030 Peptide methionine sulfoxide r... Lus10028467 2.4 0.8474
AT5G18610 Protein kinase superfamily pro... Lus10041426 5.2 0.8402
AT2G24220 ATPUP5 purine permease 5 (.1.2) Lus10036272 9.6 0.8243
AT5G35360 CAC2 acetyl Co-enzyme a carboxylase... Lus10028753 10.4 0.7792
AT1G14310 Haloacid dehalogenase-like hyd... Lus10036740 11.8 0.7590
AT3G58970 MRS2-4, MGT6 magnesium transporter 6 (.1) Lus10015459 12.2 0.7930
AT1G57680 unknown protein Lus10008924 12.5 0.7448
AT3G22540 Protein of unknown function (D... Lus10010564 13.3 0.8012
AT4G32530 ATPase, F0/V0 complex, subunit... Lus10000694 13.8 0.8131

Lus10028906 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.