Lus10028910 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62760 166 / 1e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 145 / 8e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 134 / 3e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 125 / 9e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 125 / 1e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 124 / 4e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G51520 119 / 2e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 117 / 1e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 115 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 114 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004327 379 / 1e-135 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10032232 200 / 6e-65 AT1G62760 141 / 9e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10024595 193 / 4e-62 AT1G62760 141 / 6e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 150 / 1e-45 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 137 / 1e-40 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027199 137 / 2e-40 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 129 / 3e-37 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 125 / 9e-36 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031713 125 / 9e-36 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G113600 181 / 9e-58 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 181 / 1e-57 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 154 / 6e-47 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 148 / 8e-45 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 148 / 9e-45 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 132 / 2e-38 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 131 / 4e-38 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 128 / 6e-37 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 124 / 1e-35 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.010G109300 124 / 3e-35 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10028910 pacid=23177151 polypeptide=Lus10028910 locus=Lus10028910.g ID=Lus10028910.BGIv1.0 annot-version=v1.0
ATGAGAACGTCGGCAGCAATTTTCTTTCTCTTCTTCCTTACCAAGGTAATCATTACTCCAACCGCCGCAAACCCATCGCCGGAATCGTCCACAAGGTTAA
ACCCAGACGCGGAATTCATCAAAACTTCTTGCAATTCAACCCTCTACCCTAAACGCTGCTACATAACCCTGTCCCCTTACGCCTCCGAAATCGGATCCGA
CCCGAGGAAACTGTCTTTGAAAGCTCTCAACGTGACCTTAAAAGTCACGAAATCCGCTTCCAGGCTAATGAAGAGGATGTCCAGAATGAAAGGCTTGCAG
CCCCGGATGGCTGCGGCGGTGGCGGACTGCGTGGAGGAGGTCGGAGACGCTGTGGAGGAGCTGGGGAACTCGGTCGCCGAGATGGGCGGGTCGCCCAGTC
AGGGACCCGACTTCTGCCGGGTTATTTCCGATGTTCAGACTTGGGTCAGCGCAGCGGAGACCGACGATGACACCTGTACGGACGGGTTCGACGAGGAGCA
GGCGGCGGAGGAGGAAAAGAGTTCGGCGGTGGTGAGTAGAAATGTGAAGAAGATAGTTGAGAGACACGTGGCGAGGATTTCTCGGTTTACTAGTAACGCT
CTGGCTTTGGTGAATCTCTATGCTTCTTCTTCCGAATCTAGTCAAGTTCCTTGTTGA
AA sequence
>Lus10028910 pacid=23177151 polypeptide=Lus10028910 locus=Lus10028910.g ID=Lus10028910.BGIv1.0 annot-version=v1.0
MRTSAAIFFLFFLTKVIITPTAANPSPESSTRLNPDAEFIKTSCNSTLYPKRCYITLSPYASEIGSDPRKLSLKALNVTLKVTKSASRLMKRMSRMKGLQ
PRMAAAVADCVEEVGDAVEELGNSVAEMGGSPSQGPDFCRVISDVQTWVSAAETDDDTCTDGFDEEQAAEEEKSSAVVSRNVKKIVERHVARISRFTSNA
LALVNLYASSSESSQVPC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62760 Plant invertase/pectin methyle... Lus10028910 0 1
AT5G17980 C2 calcium/lipid-binding plant... Lus10010658 6.2 0.8118
AT5G01880 RING/U-box superfamily protein... Lus10025228 6.9 0.7779
Lus10015658 9.5 0.8013
AT5G47740 Adenine nucleotide alpha hydro... Lus10019487 10.6 0.7746
Lus10003607 10.6 0.7876
AT5G47740 Adenine nucleotide alpha hydro... Lus10043338 11.5 0.7795
AT2G27035 AtENODL20 early nodulin-like protein 20 ... Lus10005229 14.4 0.8010
AT1G70280 NHL domain-containing protein ... Lus10032158 15.7 0.7929
AT5G66440 unknown protein Lus10023551 18.0 0.7928
AT1G46264 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcr... Lus10001133 20.0 0.7891

Lus10028910 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.