Lus10028912 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64950 249 / 2e-79 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 149 / 6e-41 Mitochondrial transcription termination factor family protein (.1)
AT5G07900 147 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 102 / 8e-24 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 99 / 9e-23 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 97 / 6e-22 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 96 / 9e-22 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61980 96 / 2e-21 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 86 / 3e-18 Mitochondrial transcription termination factor family protein (.1)
AT1G62150 84 / 1e-17 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004329 671 / 0 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10029199 492 / 5e-175 AT5G64950 226 / 1e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10010714 175 / 2e-52 AT4G38840 117 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Lus10008688 167 / 5e-48 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 141 / 5e-38 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 130 / 2e-34 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 129 / 1e-33 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 124 / 5e-32 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10041122 118 / 8e-30 AT5G07900 166 / 2e-47 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G190300 165 / 2e-47 AT5G07900 209 / 8e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 164 / 7e-47 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.004G222000 162 / 2e-46 AT5G07900 200 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190400 160 / 1e-45 AT5G07900 206 / 9e-63 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034700 159 / 3e-45 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.001G029400 157 / 5e-44 AT5G07900 181 / 4e-53 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 157 / 5e-44 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 155 / 1e-43 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035200 154 / 2e-43 AT5G07900 168 / 3e-48 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190700 153 / 7e-43 AT5G07900 213 / 3e-65 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10028912 pacid=23177342 polypeptide=Lus10028912 locus=Lus10028912.g ID=Lus10028912.BGIv1.0 annot-version=v1.0
ATGCTCTCTCTCTCAACTTACCGTCACAGCAATCTACGATTCGGAGCTTGCTTCGTTGCCTGCTTCTCTAAACTCGCCGAGTCCCCCTCAGCTGCATCAA
GCTCCTCTGCCCTAGTGGATTGCTTGATTGCAACCTTCAAATTTACCGACACCCAAGCCCACTCCATCGCCTCTCGCTTCCCCACTTTCAAATCTGCTAA
AAAACCCCAAGCCTTGTCCCAATTCCTTCGAGATCAGGGTTTCACCGATGCCCATATACAAGCTACAGTCTCCGGAGCACCTCAGATACTATTTGCCAAC
ATTGACAGGAATCTTAAACCCAAGATCCAGCATTTTCGTAAACTGGGCCTTGAGGGTTCTCGTCTGTGTAAATTCCTCTCGAAAAATCCCACGATTTTGA
CTGCTAGTTTGAAGGAGAAGTTGGGTCCTCGACTTGAAATTTTGCAGAAATCCGTCTCTCAGAAAGATTTAGCTAGGGGTGTAGAAAGGTGCAGTTGGGT
TCTGTTTAAGTACTCGGAATCGAGACTGTTGTCGAACATTGCATTGCTGCAGAGCTGTGGCATTGTCGGGTCTCAGCTCTCGATGCTGTTCAGAATGCAG
CCCAGGATTTTCTTGAGGGAAGAATCTGAACTTAGAGGCATTGTTTCCAGGACTTTGGATTTCGGGTTCTCGACGAAATCTAAGATGTTTGTACACGGTT
TGTACACCGTCAGCGGATGGAGTGACGCTGCCCTCGAAAGAAAATTCGCAATCTTCGACGGGTATGGATTTTCGAGGGAAGAATGTATCGGCATGTTCAG
AAAGGCACCAGTATTGCTGAGGTGCTCCGAGGAGAAGTTGAAGTTTGGGATTGATTTCTATTTGAACACAATGAAGCTGAGCAAAGAGATGATATGTAGC
AGGCCTTCGCTGTTGATGTACAGCATGACGGAAAGAGTAATTCCTCGATACCGTGTTTTGGAGATGATGGAGTCGAAGGCGCTGTTTGAAAAGAGGCCGA
ACTTCAGCACTGTTGCGAGTCTGACGAATGAGAGGTTTATCGACAAGTTCGTGTTTTGGTCGTTAGATCATGCAGAGGAACTACTAATGGCTTACAATGG
TCATGATGTCAGTGCTGCTAGAGATGAAACATGTTTGTAG
AA sequence
>Lus10028912 pacid=23177342 polypeptide=Lus10028912 locus=Lus10028912.g ID=Lus10028912.BGIv1.0 annot-version=v1.0
MLSLSTYRHSNLRFGACFVACFSKLAESPSAASSSSALVDCLIATFKFTDTQAHSIASRFPTFKSAKKPQALSQFLRDQGFTDAHIQATVSGAPQILFAN
IDRNLKPKIQHFRKLGLEGSRLCKFLSKNPTILTASLKEKLGPRLEILQKSVSQKDLARGVERCSWVLFKYSESRLLSNIALLQSCGIVGSQLSMLFRMQ
PRIFLREESELRGIVSRTLDFGFSTKSKMFVHGLYTVSGWSDAALERKFAIFDGYGFSREECIGMFRKAPVLLRCSEEKLKFGIDFYLNTMKLSKEMICS
RPSLLMYSMTERVIPRYRVLEMMESKALFEKRPNFSTVASLTNERFIDKFVFWSLDHAEELLMAYNGHDVSAARDETCL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64950 Mitochondrial transcription te... Lus10028912 0 1
AT5G06770 C3HZnF KH domain-containing protein /... Lus10021043 5.8 0.8274
AT5G64950 Mitochondrial transcription te... Lus10004329 9.1 0.8277
AT4G14700 ORC1, ATORC1A, ... origin recognition complex 1 (... Lus10031279 10.2 0.8245
AT5G16860 Tetratricopeptide repeat (TPR)... Lus10020652 21.1 0.7351
AT3G57610 ADSS, ATPURA adenylosuccinate synthase (.1) Lus10040512 28.0 0.8247
AT5G58230 MSI1, MEE70, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10020917 28.5 0.8025
AT5G04520 Protein of unknown function DU... Lus10028831 29.3 0.8259
AT1G25360 Pentatricopeptide repeat (PPR)... Lus10028106 30.0 0.7927
AT3G02330 Pentatricopeptide repeat (PPR)... Lus10014594 31.4 0.7917
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Lus10013652 36.7 0.7064

Lus10028912 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.