Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12410 105 / 2e-30 SAUR-like auxin-responsive protein family (.1) AT4G22620 99 / 1e-27 SAUR-like auxin-responsive protein family (.1) AT2G45210 94 / 7e-26 SAUR-like auxin-responsive protein family (.1) AT3G60690 87 / 3e-23 SAUR-like auxin-responsive protein family (.1) AT4G38850 75 / 4e-19 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT3G61900 76 / 8e-19 SAUR-like auxin-responsive protein family (.1) AT2G46690 74 / 3e-18 SAUR-like auxin-responsive protein family (.1) AT3G03820 71 / 2e-17 SAUR-like auxin-responsive protein family (.1) AT3G03850 69 / 7e-17 SAUR-like auxin-responsive protein family (.1) AT4G00880 69 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004337 [exp] 149 / 9e-48 AT4G12410 110 / 2e-31 SAUR-like auxin-responsive protein family (.1) Lus10024600 [exp] 112 / 6e-33 AT4G12410 149 / 3e-46 SAUR-like auxin-responsive protein family (.1) Lus10032237 [exp] 110 / 5e-32 AT4G12410 149 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10009286 [exp] 86 / 2e-22 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10015879 [exp] 85 / 4e-22 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 84 / 6e-22 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10010110 [exp] 70 / 1e-16 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 68 / 3e-16 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 67 / 1e-15 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G113100 [exp] 97 / 8e-27 AT4G12410 149 / 1e-46 SAUR-like auxin-responsive protein family (.1) Potri.001G119900 [exp] 94 / 1e-25 AT4G12410 140 / 8e-43 SAUR-like auxin-responsive protein family (.1) Potri.014G066900 [exp] 93 / 2e-25 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 92 / 9e-25 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 72 / 5e-18 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 71 / 4e-17 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 69 / 3e-16 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 68 / 4e-16 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 66 / 2e-15 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 66 / 3e-15 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10028920 pacid=23177144 polypeptide=Lus10028920 locus=Lus10028920.g ID=Lus10028920.BGIv1.0 annot-version=v1.0 ATGGGTCGATTGAGAGCGGAGGAGGTGCCGCCGAGGGGCCACTTGGCGGTCTACGTCGGGGAATCCGACGACGGGAAAATGCGGGTAGTGGTACCCGTGT TTTACTTCAACAACCCGCTGTTCGGGGAGCTACTTAAGGAGGCGGAGCGGGTCTACGGGTTCGATCGTCCGGGTGGGATCAGTATCCCGTGTGGGTATTC CAAGTTTGAGAAGGTTGAGATGAAAATCAATGAACGGGACGGGTTTATTCGCCGCCGACGACACTTTTTGCGGCGGTGGGGGTTAATGAGATAG
AA sequence Show only first row Show all	>Lus10028920 pacid=23177144 polypeptide=Lus10028920 locus=Lus10028920.g ID=Lus10028920.BGIv1.0 annot-version=v1.0 MGRLRAEEVPPRGHLAVYVGESDDGKMRVVVPVFYFNNPLFGELLKEAERVYGFDRPGGISIPCGYSKFEKVEMKINERDGFIRRRRHFLRRWGLMR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12410			SAUR-like auxin-responsive pro...		Lus10028920 [exp]	0	1
AT4G39010		ATGH9B18	glycosyl hydrolase 9B18 (.1)		Lus10042071 [exp]	7.9	0.4793
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10012493 [exp]	21.6	0.4661
					Lus10016118 [exp]	40.4	0.4392
AT1G05675			UDP-Glycosyltransferase superf...		Lus10010469 [exp]	42.0	0.4392
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Lus10004323 [exp]	85.5	0.4058
					Lus10007605 [exp]	105.4	0.3815
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10005660 [exp]	151.3	0.3694
AT5G39300		ATHEXPALPHA1.18...	EXPANSIN 25, expansin A25 (.1)		Lus10000305 [exp]	152.0	0.3691

Compare expression of checked genes

Lus10028920 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.