Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12510 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 89 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 82 / 3e-20 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 80 / 8e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 80 / 1e-19 AZI1 azelaic acid induced 1 (.1) AT2G45180 79 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12545 78 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 78 / 4e-19 ELP extensin-like protein (.1) AT4G12550 77 / 4e-19 AIR1 Auxin-Induced in Root cultures 1 (.1) AT4G12500 77 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004348 [exp] 138 / 9e-43 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 108 / 6e-31 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10024626 [exp] 107 / 1e-30 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032259 [exp] 92 / 6e-25 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 92 / 1e-24 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024623 [exp] 87 / 3e-22 AT4G12490 152 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024625 [exp] 83 / 5e-21 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024620 [exp] 80 / 2e-19 AT4G12490 150 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032257 [exp] 79 / 2e-19 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G158400 [exp] 93 / 5e-25 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 81 / 2e-20 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 79 / 9e-20 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 71 / 3e-16 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 70 / 6e-16 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 69 / 1e-15 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G256100 [exp] 67 / 3e-15 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 65 / 3e-14 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 59 / 1e-11 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 59 / 3e-11 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10028929 pacid=23177271 polypeptide=Lus10028929 locus=Lus10028929.g ID=Lus10028929.BGIv1.0 annot-version=v1.0 ATGGCTTCCAACGCCAACTCTGCCATTGCTCTGTTCCTACTCCTCAACGTTCTCTTCTTCACCATGGTCTCAGCCACACACAATGCAGGCTGCCCACCTC CCCCGCCGAAACCAGCCGACTGCCCGCCTTCCCCTTCCAAACCGAAACCAACCCCAGCTTCCTCCGGGAAGTGCCCCGTTGACACCCTGAAATTGGGAGT ATGTGGCAGCGTGTTGGGCTCGTTGCTCAAGATCAAGATCGGGGACCCGCCGGTCAAGCCTTGCTGTAGTTTGATCGAAGGGCTAGTCGATCTCGAGGCT GCTGTTTGCCTTTGCACCGCGATTAAGGCCAACATTCTCGGAATCCACCTCAATGTCCCGGTTTCTCTGAGCTTGCTGCTCAATGTTTGCAGCAAGAAGG CCCCATCCGGATTCCAGTGCCCCTAG
AA sequence Show only first row Show all	>Lus10028929 pacid=23177271 polypeptide=Lus10028929 locus=Lus10028929.g ID=Lus10028929.BGIv1.0 annot-version=v1.0 MASNANSAIALFLLLNVLFFTMVSATHNAGCPPPPPKPADCPPSPSKPKPTPASSGKCPVDTLKLGVCGSVLGSLLKIKIGDPPVKPCCSLIEGLVDLEA AVCLCTAIKANILGIHLNVPVSLSLLLNVCSKKAPSGFQCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10028929 [exp]	0	1
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10004348 [exp]	1.0	0.9935
AT5G11420			Protein of unknown function, D...		Lus10035910 [exp]	2.0	0.9691
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Lus10005327 [exp]	2.4	0.9688
AT5G40390		RS5, SIP1	seed imbibition 1-like, raffin...		Lus10027679 [exp]	2.6	0.9566
AT2G44740		CYCP4;1	cyclin p4;1 (.1)		Lus10043003 [exp]	3.5	0.9649
AT2G20520		FLA6	FASCICLIN-like arabinogalactan...		Lus10033651 [exp]	3.9	0.9586
AT1G72160			Sec14p-like phosphatidylinosit...		Lus10001542 [exp]	4.5	0.9422
AT4G28720		YUC8	YUCCA 8, Flavin-binding monoox...		Lus10000494 [exp]	5.1	0.9480
AT1G08590			Leucine-rich receptor-like pro...		Lus10000814 [exp]	5.8	0.9247
AT2G03350			Protein of unknown function, D...		Lus10037126 [exp]	6.7	0.9523

Compare expression of checked genes

Lus10028929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.