Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62500 131 / 4e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G10940 100 / 3e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22142 93 / 1e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G15160 86 / 9e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G22120 88 / 2e-20 CWLP cell wall-plasma membrane linker protein (.1) AT1G12100 69 / 7e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 69 / 8e-15 AZI1 azelaic acid induced 1 (.1) AT4G12480 66 / 2e-13 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 65 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 64 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004349 [exp] 136 / 8e-40 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032262 [exp] 136 / 2e-39 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010482 [exp] 94 / 9e-25 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10003801 [exp] 96 / 1e-23 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10027704 [exp] 91 / 6e-23 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032259 [exp] 74 / 5e-17 AT4G12520 133 / 2e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010479 [exp] 76 / 2e-16 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001493 [exp] 72 / 6e-16 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004346 [exp] 72 / 9e-16 AT4G12520 161 / 2e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G111300 [exp] 124 / 4e-35 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G065500 [exp] 107 / 8e-29 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.018G126000 [exp] 106 / 2e-27 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.006G008500 [exp] 97 / 4e-25 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 95 / 9e-24 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G015500 [exp] 97 / 2e-23 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.018G025900 [exp] 75 / 4e-17 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121800 [exp] 70 / 2e-15 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 70 / 4e-15 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 68 / 1e-14 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028930 pacid=23177320 polypeptide=Lus10028930 locus=Lus10028930.g ID=Lus10028930.BGIv1.0 annot-version=v1.0 ATGGCTTCTTCTTCAAAACTAATAGCCTTGATATTCATCTCCATGCATCTCATTCTAATCTCCTTGCCTCCTACTTACGCTTGTGTCCCTTGCACTCACC CAAACCCACCCTCCGGCCACACCCCAACCGGCCGTCCACATCCCCCCACCACCCGCCCACCCCACCACGGCGGAGGCCGCGGTGGTCACCATGGTAAAGG CAAAGGCAAAGGAGGTGGCGGAGGCAAAGGGCATAATCGTCCACCACCAATAGTTTCACCACCCATCATAGTCAACCCTACTCCTCCGGTTACATACCCT CCTCCGGTGGTGACGCCTCCAGTTATAAACCCACCTCCTCCTTCTTCTGTGCCATGTCCTCCTCCGGCAGCTAAGCAACCCACGTGTCCGATCGGAGGGC TGAAGCTAGGCGCGTGCGTGGACGTGCTGGGAGGGTTGGTGCACGTAGGGGTAGGGAACCCAGTGGAGAATGTGTGCTGTCCGGTGATTAAAGGGCTGCT GGAGATTGAAGCCGCCGTTTGTTTGTGCACGTCGATAAGGCTGAAGCTGCTTAACATCAACATCTTCATTCCTTTAGCACTTCAAGCTCTCATCACCTGC GGCAAGACTCCTCCTCCTGGCTTCGTTTGCCCTCCACTTTGA
AA sequence Show only first row Show all	>Lus10028930 pacid=23177320 polypeptide=Lus10028930 locus=Lus10028930.g ID=Lus10028930.BGIv1.0 annot-version=v1.0 MASSSKLIALIFISMHLILISLPPTYACVPCTHPNPPSGHTPTGRPHPPTTRPPHHGGGRGGHHGKGKGKGGGGGKGHNRPPPIVSPPIIVNPTPPVTYP PPVVTPPVINPPPPSSVPCPPPAAKQPTCPIGGLKLGACVDVLGGLVHVGVGNPVENVCCPVIKGLLEIEAAVCLCTSIRLKLLNINIFIPLALQALITC GKTPPPGFVCPPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62500			Bifunctional inhibitor/lipid-t...		Lus10028930 [exp]	0	1
AT1G12600			UDP-N-acetylglucosamine (UAA) ...		Lus10009315 [exp]	1.0	0.8962
AT1G62500			Bifunctional inhibitor/lipid-t...		Lus10004349 [exp]	3.9	0.8813
AT1G72570	AP2_ERF		Integrase-type DNA-binding sup...		Lus10037670 [exp]	6.5	0.8564
AT5G52860		ABCG8	ATP-binding cassette G8, ABC-2...		Lus10039304 [exp]	7.5	0.8825
AT2G33620	AT-hook		AT hook motif DNA-binding fami...		Lus10000315 [exp]	11.2	0.8767
AT3G02710			ARM repeat superfamily protein...		Lus10031364 [exp]	13.4	0.8594
AT2G36400	GRF	ATGRF3	growth-regulating factor 3 (.1...		Lus10023877 [exp]	16.1	0.8782
AT1G72210	bHLH	bHLH096	basic helix-loop-helix (bHLH) ...		Lus10001271 [exp]	16.9	0.8429
AT1G01110		IQD18	IQ-domain 18 (.1.2)		Lus10008269 [exp]	18.0	0.8728
AT1G80660		AHA9	H\(+\)-ATPase 9, H\(+\)-ATPase...		Lus10002326 [exp]	20.3	0.8664

Compare expression of checked genes

Lus10028930 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.