Lus10028931 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17260 72 / 6e-16 Lactate/malate dehydrogenase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004350 132 / 4e-38 AT4G17260 550 / 0.0 Lactate/malate dehydrogenase family protein (.1)
Lus10002983 125 / 1e-37 AT4G17260 159 / 3e-48 Lactate/malate dehydrogenase family protein (.1)
Lus10006030 86 / 2e-20 AT4G17260 124 / 9e-32 Lactate/malate dehydrogenase family protein (.1)
Lus10002982 67 / 4e-15 AT4G17260 198 / 6e-64 Lactate/malate dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G135920 92 / 1e-23 AT4G17260 372 / 1e-130 Lactate/malate dehydrogenase family protein (.1)
Potri.001G122400 93 / 2e-23 AT4G17260 545 / 0.0 Lactate/malate dehydrogenase family protein (.1)
Potri.003G111201 57 / 2e-10 AT4G17260 477 / 3e-171 Lactate/malate dehydrogenase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
Representative CDS sequence
>Lus10028931 pacid=23177097 polypeptide=Lus10028931 locus=Lus10028931.g ID=Lus10028931.BGIv1.0 annot-version=v1.0
ATGCACAAAACGCCTTCAGGTTCATCGCTAGGCGGCCCCGACGGCCTAGACCTAACCCAAACATTTTTCAAACCCATCCAGAGAACCGACTCGCTCTACT
CATCCAAGCGCTCCATCACCAAGATCTCCGTCATTGGCGTCGGCAACGTCGGTATGGCCATCGCCCAAACCATCCTCACCCAGGACCTTGCCGACGAGAT
CGCTCTAGTCGACGCTAACGACGACAAGCTCCGCGGCGAGATGCTTGTCAAATCTTCAACTGGCTCTGAACCTCAATGCGTATCCAATGCTATCTGCTGC
TGCTCCAAGAAGCTTATTATCGGCACTCCCCCAACGCTTATGCTCGACCACAGCGCCACCGAGCTGTCACCGTGCTCCCCCACTACGTACGCCTAA
AA sequence
>Lus10028931 pacid=23177097 polypeptide=Lus10028931 locus=Lus10028931.g ID=Lus10028931.BGIv1.0 annot-version=v1.0
MHKTPSGSSLGGPDGLDLTQTFFKPIQRTDSLYSSKRSITKISVIGVGNVGMAIAQTILTQDLADEIALVDANDDKLRGEMLVKSSTGSEPQCVSNAICC
CSKKLIIGTPPTLMLDHSATELSPCSPTTYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17260 Lactate/malate dehydrogenase f... Lus10028931 0 1
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10000843 3.3 1.0000
AT5G12180 CPK17 calcium-dependent protein kina... Lus10000889 3.5 1.0000
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10003277 3.9 1.0000
Lus10005378 4.0 1.0000
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10001774 4.9 1.0000
Lus10015823 5.4 1.0000
Lus10022529 6.2 1.0000
AT2G47940 EMB3117, DEGP2 EMBRYO DEFECTIVE 3117, DEGP pr... Lus10040905 6.3 1.0000
AT3G49055 unknown protein Lus10011651 6.6 1.0000
AT2G38500 2-oxoglutarate (2OG) and Fe(II... Lus10006093 6.7 1.0000

Lus10028931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.