Lus10028932 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16515 43 / 4e-06 RGF6 root meristem growth factor 6, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004351 140 / 2e-43 ND 45 / 8e-07
Lus10008506 49 / 4e-08 AT4G16515 47 / 2e-08 root meristem growth factor 6, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G122600 44 / 6e-06 AT4G16515 45 / 9e-07 root meristem growth factor 6, unknown protein
PFAM info
Representative CDS sequence
>Lus10028932 pacid=23177311 polypeptide=Lus10028932 locus=Lus10028932.g ID=Lus10028932.BGIv1.0 annot-version=v1.0
ATGTCTCGAGTTCTGGCGTGGCTACTGCTCGTTTCTCTTTCGGTGCATGCATGCACTGCTCGGCAACTCATCACTCACGACCAAGCTAGTAGTGATGTTT
CCGTTTTTAGTTCGGCGTCGTCGGAAGGCGAACCCCGAACACAAGTTGCAGAATGGACTTTGCTCGGTGCAATTACGTCCTGCATCAAGCACAGTCCTCT
GAAGCAGGAGAAAGATGATAAAATAAAAGAGGGGATGAAGAAGACATGGAGAGGAAGAGGTCTAATGGCAGGGAAGAATATGAAGAAGAAGAAGAAGACG
ACGGAGAAGAAGGAATCCAATGCTAGCGGAGACGAGGCAGAAAAAGAAGAAGGGAATACTAGTATTGTTATGATGGATTATGCTCAGCCCCATCGAAAGC
CCCCGATCCACAACGAAAAACACTGA
AA sequence
>Lus10028932 pacid=23177311 polypeptide=Lus10028932 locus=Lus10028932.g ID=Lus10028932.BGIv1.0 annot-version=v1.0
MSRVLAWLLLVSLSVHACTARQLITHDQASSDVSVFSSASSEGEPRTQVAEWTLLGAITSCIKHSPLKQEKDDKIKEGMKKTWRGRGLMAGKNMKKKKKT
TEKKESNASGDEAEKEEGNTSIVMMDYAQPHRKPPIHNEKH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028932 0 1
AT3G21720 ICL isocitrate lyase (.1) Lus10031552 9.1 1.0000
AT4G34760 SAUR-like auxin-responsive pro... Lus10028466 10.5 0.9971
Lus10025806 13.0 1.0000
AT3G21720 ICL isocitrate lyase (.1) Lus10015122 14.4 0.9979
AT1G02050 LAP6 LESS ADHESIVE POLLEN 6, Chalco... Lus10002187 15.3 0.9956
Lus10026755 15.9 1.0000
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10024627 17.7 0.9978
AT4G17260 Lactate/malate dehydrogenase f... Lus10028931 18.3 1.0000
Lus10039439 19.0 0.9998
Lus10010593 19.3 0.9995

Lus10028932 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.