Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16520 216 / 3e-74 ATG8F autophagy 8f, Ubiquitin-like superfamily protein (.1.2) AT2G45170 209 / 2e-71 ATATG8E AUTOPHAGY 8E (.1.2) AT3G60640 207 / 1e-70 ATG8G AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) AT1G62040 200 / 1e-67 ATG8C autophagy 8c, Ubiquitin-like superfamily protein (.1.2) AT2G05630 198 / 5e-67 ATG8D Ubiquitin-like superfamily protein (.1.2) AT4G21980 188 / 5e-63 ATG8A, APG8A AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) AT4G04620 182 / 1e-60 ATG8B autophagy 8b, Ubiquitin-like superfamily protein (.1.2) AT3G15580 130 / 2e-40 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) AT3G06420 125 / 3e-38 ATG8H autophagy 8h, Ubiquitin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008507 [exp] 224 / 3e-77 AT4G16520 216 / 3e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10004352 [exp] 223 / 8e-77 AT2G45170 203 / 1e-68 AUTOPHAGY 8E (.1.2) Lus10000733 [exp] 222 / 1e-76 AT4G16520 217 / 1e-74 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Lus10015563 [exp] 201 / 2e-68 AT1G62040 230 / 1e-79 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Lus10027186 [exp] 199 / 2e-67 AT2G05630 222 / 1e-76 Ubiquitin-like superfamily protein (.1.2) Lus10039656 [exp] 184 / 2e-60 AT2G05630 203 / 6e-68 Ubiquitin-like superfamily protein (.1.2) Lus10038046 [exp] 129 / 1e-39 AT3G15580 199 / 1e-67 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1) Lus10009987 [exp] 120 / 9e-33 AT3G62240 625 / 0.0 RING/U-box superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G136040 [exp] 225 / 8e-78 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.003G110901 [exp] 225 / 8e-78 AT4G16520 197 / 1e-66 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.002G144600 [exp] 223 / 9e-77 AT3G60640 192 / 8e-65 AUTOPHAGY 8G, Ubiquitin-like superfamily protein (.1) Potri.001G122700 [exp] 222 / 2e-76 AT4G16520 191 / 2e-64 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.014G060300 [exp] 217 / 1e-74 AT4G16520 214 / 1e-73 autophagy 8f, Ubiquitin-like superfamily protein (.1.2) Potri.014G153800 [exp] 201 / 3e-68 AT2G05630 202 / 6e-69 Ubiquitin-like superfamily protein (.1.2) Potri.002G228800 [exp] 199 / 1e-67 AT2G05630 224 / 1e-77 Ubiquitin-like superfamily protein (.1.2) Potri.011G004300 [exp] 194 / 4e-65 AT4G21980 219 / 1e-74 AUTOPHAGY-RELATED 8A, AUTOPHAGY 8A, Ubiquitin-like superfamily protein (.1.2) Potri.004G013700 [exp] 192 / 5e-65 AT1G62040 216 / 3e-74 autophagy 8c, Ubiquitin-like superfamily protein (.1.2) Potri.008G099400 [exp] 131 / 9e-41 AT3G15580 187 / 7e-63 AUTOPHAGY 8I, AUTOPHAGY 8H, Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02991 [flax] [poplar] Atg8 Autophagy protein Atg8 ubiquitin like
Representative CDS sequence Show only first row Show all	>Lus10028933 pacid=23177177 polypeptide=Lus10028933 locus=Lus10028933.g ID=Lus10028933.BGIv1.0 annot-version=v1.0 ATGACTAAGAGTTGCTTCAGACAAGAGCATGACCATGAGAAGAGAAAGGCTGAGGCTGCCAGGATAAGGGAGAAGTACCCAGATAGAATTCCGGTCATTG TGGAGAAGGCGGAGAGAAGCGAAATACCAAACATAGACAAGAAAAAGTACCTAGTCCCATCCGACTTGACTGTCGGACAGTTTGTTTACGTAATCCGGAA GAGGATCAAACTGAGTGCTGAAAAGGCGATCTTCATATTCGTTGACAATGTCCTGCCACCAACCGGTGCTGTAATGTCTGCACTATATGAAGAAAAGAAG GATGAAGACGGATTTCTCTATGTTACTTACAGCGGCGAGAATACTTTCGGAATGGAGATTCATCAGTAG
AA sequence Show only first row Show all	>Lus10028933 pacid=23177177 polypeptide=Lus10028933 locus=Lus10028933.g ID=Lus10028933.BGIv1.0 annot-version=v1.0 MTKSCFRQEHDHEKRKAEAARIREKYPDRIPVIVEKAERSEIPNIDKKKYLVPSDLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPTGAVMSALYEEKK DEDGFLYVTYSGENTFGMEIHQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Lus10028933 [exp]	0	1
AT1G10070		ATBCAT-2	branched-chain amino acid tran...		Lus10007247 [exp]	1.7	0.9827
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Lus10042516 [exp]	3.2	0.9805
AT5G65210	bZIP	TGA1	bZIP transcription factor fami...		Lus10035873 [exp]	4.0	0.9780
AT3G16990			Haem oxygenase-like, multi-hel...		Lus10037751 [exp]	4.6	0.9786
AT2G23450			Protein kinase superfamily pro...		Lus10011652 [exp]	5.9	0.9754
AT2G23450			Protein kinase superfamily pro...		Lus10032741 [exp]	6.0	0.9709
AT5G41810			unknown protein		Lus10003901 [exp]	8.1	0.9764
AT1G56090			Tetratricopeptide repeat (TPR)...		Lus10031774 [exp]	8.1	0.9597
AT3G20250		APUM5	pumilio 5 (.1)		Lus10034808 [exp]	8.1	0.9719
AT1G13195			RING/U-box superfamily protein...		Lus10006253 [exp]	8.4	0.9702

Compare expression of checked genes

Lus10028933 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.