Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35736 96 / 2e-28 unknown protein AT4G25225 79 / 1e-21 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004354 [exp] 119 / 7e-38 AT2G35736 95 / 4e-28 unknown protein Lus10000732 [exp] 79 / 1e-21 AT2G35736 73 / 1e-19 unknown protein Lus10027209 [exp] 74 / 1e-19 AT4G25225 82 / 8e-23 unknown protein Lus10038922 [exp] 75 / 2e-19 AT4G25225 81 / 2e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G123000 [exp] 96 / 1e-28 AT2G35736 91 / 1e-26 unknown protein Potri.001G124100 [exp] 84 / 2e-23 AT4G25225 90 / 6e-26 unknown protein Potri.014G059600 [exp] 75 / 5e-20 AT4G25225 87 / 8e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028935 pacid=23177277 polypeptide=Lus10028935 locus=Lus10028935.g ID=Lus10028935.BGIv1.0 annot-version=v1.0 ATGGGGATCTTGAGGAGCGGGTTCTCGTTTATACTCGGTACGTCTTTCGGCATCTACCTTGCTCAGAACTACAACGTCCCTAACATACGCAAGCTCGCCA ACACCGGCATGGTTATCGCCAAACACATCGAGGAGTCGTATAGGAAGCCCAAGAAGACTGACGTTGACGATTGA
AA sequence Show only first row Show all	>Lus10028935 pacid=23177277 polypeptide=Lus10028935 locus=Lus10028935.g ID=Lus10028935.BGIv1.0 annot-version=v1.0 MGILRSGFSFILGTSFGIYLAQNYNVPNIRKLANTGMVIAKHIEESYRKPKKTDVDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35736			unknown protein		Lus10028935 [exp]	0	1
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Lus10040022 [exp]	1.7	0.8979
AT2G37680		PAT3, FRY1, FHY...	unknown protein		Lus10023781 [exp]	2.4	0.8843
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Lus10019602 [exp]	3.9	0.8821
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	4.6	0.8658
AT3G05870		APC11	anaphase-promoting complex/cyc...		Lus10015126 [exp]	6.7	0.8627
AT1G76860			Small nuclear ribonucleoprotei...		Lus10042341 [exp]	7.7	0.8372
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10038878 [exp]	8.9	0.8653
AT3G07750			3'-5'-exoribonuclease family p...		Lus10001173 [exp]	9.8	0.8569
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	12.6	0.8725
AT3G01435			Expressed protein (.1)		Lus10003331 [exp]	12.6	0.8328

Compare expression of checked genes

Lus10028935 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.