Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01110 117 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G61990 82 / 5e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64100 79 / 7e-19 pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) AT1G19290 78 / 2e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63150 77 / 3e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63330 76 / 7e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63630 75 / 7e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G05670 76 / 9e-18 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) AT1G12300 76 / 9e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G39710 76 / 1e-17 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007468 [exp] 170 / 3e-51 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019524 [exp] 86 / 4e-21 AT3G54980 716 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10013077 [exp] 76 / 1e-17 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10027916 [exp] 74 / 4e-17 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028943 [exp] 73 / 5e-17 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027914 [exp] 73 / 1e-16 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10032789 [exp] 73 / 1e-16 AT1G09820 250 / 4e-78 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10012068 [exp] 73 / 2e-16 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013283 [exp] 72 / 2e-16 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G276500 [exp] 139 / 6e-40 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G250700 [exp] 84 / 9e-21 AT3G54980 781 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G117600 [exp] 79 / 7e-19 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.009G105600 [exp] 79 / 8e-19 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G035700 [exp] 77 / 3e-18 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Potri.013G032600 [exp] 76 / 9e-18 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.016G025600 [exp] 76 / 2e-17 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G105700 [exp] 74 / 5e-17 AT4G19440 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.018G038300 [exp] 74 / 6e-17 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.015G105400 [exp] 73 / 1e-16 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10028942 pacid=23177310 polypeptide=Lus10028942 locus=Lus10028942.g ID=Lus10028942.BGIv1.0 annot-version=v1.0 ATGGAAAGCCAAGGGTTGTTGCCGAATATTGTCACTTATAACGCAATCCTGAATGGGTTTTGTAGTCTAGGCAGAATGCAAGATGCTGAATCGGTGCTTC AGAAAATGATTGAGAAGGGCGTATATCCTGATCGATCCACATACACAGCTCTTATAAATGGACATGTCAGCCAGGAGAACTTAAAGGAGGCGTTTCGATT CCATGATGAAATGTTACTCAGAGGTTTTGTACCAGATGACGATACTTGA
AA sequence Show only first row Show all	>Lus10028942 pacid=23177310 polypeptide=Lus10028942 locus=Lus10028942.g ID=Lus10028942.BGIv1.0 annot-version=v1.0 MESQGLLPNIVTYNAILNGFCSLGRMQDAESVLQKMIEKGVYPDRSTYTALINGHVSQENLKEAFRFHDEMLLRGFVPDDDT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028942 [exp]	0	1
AT5G24670		TAD3, EMB2820	tRNA adenosine deaminase 3, EM...		Lus10040753 [exp]	1.0	0.9328
AT2G38940		PHT1;4, ATPT2	ARABIDOPSIS THALIANA PHOSPHATE...		Lus10033866 [exp]	1.4	0.9256
					Lus10011631 [exp]	2.0	0.9125
AT4G03230			S-locus lectin protein kinase ...		Lus10033752 [exp]	2.6	0.8706
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	3.0	0.9146
AT1G22540			Major facilitator superfamily ...		Lus10001287 [exp]	5.2	0.8684
AT3G07360		ATPUB9	ARABIDOPSIS THALIANA PLANT U-B...		Lus10024776 [exp]	5.5	0.8770
AT2G16280		KCS9	3-ketoacyl-CoA synthase 9 (.1)		Lus10040578 [exp]	6.5	0.8469
					Lus10014031 [exp]	8.8	0.8602
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	10.0	0.8962

Compare expression of checked genes

Lus10028942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.