Lus10028943 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G01110 300 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G05670 186 / 1e-54 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G12700 181 / 9e-53 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
AT4G11690 175 / 2e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G09900 174 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G53700 174 / 3e-50 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12775 172 / 7e-50 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G64100 172 / 1e-49 pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
AT5G39710 172 / 2e-49 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G62910 170 / 3e-49 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007468 487 / 2e-170 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10013283 189 / 5e-56 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10036506 181 / 1e-52 AT2G16880 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10041421 179 / 3e-51 AT2G16880 668 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10039056 175 / 3e-50 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042016 172 / 6e-50 AT2G32630 600 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10027916 174 / 7e-50 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10018019 171 / 2e-49 AT2G32630 590 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10027914 171 / 7e-49 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G276500 368 / 8e-124 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G035700 185 / 4e-54 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.013G034300 179 / 8e-54 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G147700 182 / 2e-53 AT2G15630 736 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050400 179 / 2e-52 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G034200 178 / 4e-52 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G014500 179 / 6e-52 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.017G131600 176 / 1e-51 AT4G11690 632 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.005G038400 176 / 3e-51 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046000 176 / 4e-51 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10028943 pacid=23177160 polypeptide=Lus10028943 locus=Lus10028943.g ID=Lus10028943.BGIv1.0 annot-version=v1.0
ATGCAGAAATCTGGTTTTGTTCCTGATAATGTGATCTACACTATTCTTATAGATGGGCATTGTAGAAATGGCATGATGACTGAGGCAATGAAGATTCGGG
ATGTAATGCTTCAGAAGGGTTGTATTTTGGATGTGATAACATACAATACTATATTGAACGGATTATGCAAGGAGAAGATGCTCACAGATGCTGATAATTT
GCTGGACGAGATGATGGAGAGAGGTATGTTCCCTGACTTTTACACTTACACCACTCTTATCAATGGACATTGTAAAAATGGAGATTTGAGCAAGGCTCAA
AGCTTGTTTGAGACGATGAAGTTGAAACATATAAAAGCAGACATTGTGACATACAATGCATTAATTGATGGATTTTGCAAAATTGGTGAAATGGAGAAAG
CGAATCAGCTATGGCATGACATGATTTCTAGAAAGATGCTTCCGAATCACATTTCGTATGGCACTCTGATAAATGGATATTGCAGTTTAGGTAGTGTATC
TGAGGCCTTCAGGTTATTGGATGAGATGATTGAAAGGGGTATTAGACCCAGTCTTGTTACATGTAACACTGTTATAAAGGGATATTGCCTGTCCGGCAAT
GCTTCAAAAGCAGTTGAGTTCTTGGATAAGATGACTGCAAAAGAAATTTTTCCAGACAATATCACATTCAACACCCTCATTTCTAGTTTTGTGAGAGGAG
AAAATATGGACAAAGCATAG
AA sequence
>Lus10028943 pacid=23177160 polypeptide=Lus10028943 locus=Lus10028943.g ID=Lus10028943.BGIv1.0 annot-version=v1.0
MQKSGFVPDNVIYTILIDGHCRNGMMTEAMKIRDVMLQKGCILDVITYNTILNGLCKEKMLTDADNLLDEMMERGMFPDFYTYTTLINGHCKNGDLSKAQ
SLFETMKLKHIKADIVTYNALIDGFCKIGEMEKANQLWHDMISRKMLPNHISYGTLINGYCSLGSVSEAFRLLDEMIERGIRPSLVTCNTVIKGYCLSGN
ASKAVEFLDKMTAKEIFPDNITFNTLISSFVRGENMDKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G01110 Tetratricopeptide repeat (TPR)... Lus10028943 0 1
AT1G49480 B3 REM19, RTV1 related to vernalization1 1 (.... Lus10009214 6.2 0.7260
AT5G23200 unknown protein Lus10017393 9.6 0.7043
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10022111 17.7 0.7082
AT5G01910 unknown protein Lus10035364 23.5 0.6645
AT4G37460 SRFR1 SUPPRESSOR OF RPS4-RLD 1, Tetr... Lus10014863 27.2 0.6891
AT3G52750 FTSZ2-2 Tubulin/FtsZ family protein (.... Lus10022718 28.7 0.6195
AT3G25970 Pentatricopeptide repeat (PPR)... Lus10030249 33.4 0.6657
AT3G01460 MBD9, ATMBD9 methyl-CPG-binding domain 9 (.... Lus10030624 40.8 0.6501
AT5G32440 Ubiquitin system component Cue... Lus10027699 43.5 0.6160
AT5G02440 unknown protein Lus10000246 57.1 0.6203

Lus10028943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.