Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01110 112 / 7e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G53700 96 / 4e-24 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12620 91 / 5e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12300 89 / 1e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62590 87 / 5e-21 pentatricopeptide (PPR) repeat-containing protein (.1) AT5G64320 87 / 7e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12700 87 / 8e-21 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G63330 86 / 1e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12775 86 / 2e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G39710 85 / 4e-20 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007468 [exp] 243 / 2e-77 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10012037 [exp] 96 / 8e-24 AT2G15630 677 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10032789 [exp] 90 / 4e-22 AT1G09820 250 / 4e-78 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10027916 [exp] 90 / 9e-22 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10012328 [exp] 89 / 1e-21 AT3G53700 1010 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10027914 [exp] 88 / 4e-21 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10006373 [exp] 88 / 4e-21 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012068 [exp] 88 / 5e-21 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10023863 [exp] 87 / 8e-21 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G276500 [exp] 140 / 2e-39 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.009G105600 [exp] 96 / 5e-24 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G147700 [exp] 95 / 2e-23 AT2G15630 736 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.013G149800 [exp] 94 / 2e-23 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050400 [exp] 91 / 2e-22 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.017G032100 [exp] 90 / 9e-22 AT1G62930 451 / 2e-152 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G045000 [exp] 89 / 1e-21 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 89 / 1e-21 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G271400 [exp] 89 / 2e-21 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050240 [exp] 89 / 3e-21 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10028944 pacid=23177318 polypeptide=Lus10028944 locus=Lus10028944.g ID=Lus10028944.BGIv1.0 annot-version=v1.0 ATGGAGGCCAGATGTATTTTCGCTGATGATGTGACGTTTAATACTCTAATCAGTGCACATTGCCGCGAAGGACATGTGGATCAGGCTTTGCATGTCATGG AGTTAATGTCTAGTAAAGGTTTCAAAGCAAACCGTCTTACATACAACTGTATTATGAACGGTTACTGTAAAATAGGGAAATATAAAAGGGCGAAGGGTGT TCTGGACAAATTATTGCTGGATGGATATAGTCCTGATGCAGCTAGTTATAATACATTGCTTGTTGAGAGCTGTAGAAATACTGAAGCTGAGGAACTTTTT AGTGAAATGCTGAACCGAAGTGTTGCTCCTGATATAATCAGCTTCACTTCCCTCATTGGACCTCTACAAGAAAGGGGCATCTTTATAGAGCGCTGA
AA sequence Show only first row Show all	>Lus10028944 pacid=23177318 polypeptide=Lus10028944 locus=Lus10028944.g ID=Lus10028944.BGIv1.0 annot-version=v1.0 MEARCIFADDVTFNTLISAHCREGHVDQALHVMELMSSKGFKANRLTYNCIMNGYCKIGKYKRAKGVLDKLLLDGYSPDAASYNTLLVESCRNTEAEELF SEMLNRSVAPDIISFTSLIGPLQERGIFIER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028944 [exp]	0	1
AT1G02816			Protein of unknown function, D...		Lus10018818 [exp]	11.0	0.6481
AT4G37460		SRFR1	SUPPRESSOR OF RPS4-RLD 1, Tetr...		Lus10014863 [exp]	14.0	0.6850
AT4G31990		AAT3, ATAAT1, A...	ASPARTATE AMINOTRANSFERASE DEF...		Lus10001753 [exp]	23.2	0.6720
AT1G31420		FEI1	FEI 1, Leucine-rich repeat pro...		Lus10034739 [exp]	25.1	0.6658
AT5G44440			FAD-binding Berberine family p...		Lus10023367 [exp]	32.5	0.6629
AT4G31580		SRZ22, RSZP22, ...	RS-containing zinc finger prot...		Lus10026925 [exp]	35.2	0.6163
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10004309 [exp]	51.2	0.6326
AT5G03260		LAC11	laccase 11 (.1)		Lus10013800 [exp]	59.7	0.6326
AT3G01460		MBD9, ATMBD9	methyl-CPG-binding domain 9 (....		Lus10030624 [exp]	59.8	0.6158
AT5G24310		ABIL3	ABL interactor-like protein 3 ...		Lus10023052 [exp]	60.5	0.5873

Compare expression of checked genes

Lus10028944 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.