Lus10028947 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14130 432 / 3e-154 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 425 / 1e-151 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G57550 375 / 3e-132 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G25810 363 / 4e-127 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT4G30270 357 / 3e-125 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57560 357 / 5e-125 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT5G57530 352 / 1e-122 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 347 / 4e-121 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT4G25820 343 / 2e-119 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
AT5G48070 333 / 3e-115 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008522 420 / 2e-149 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10000678 416 / 4e-148 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10004723 415 / 1e-147 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 413 / 9e-147 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 380 / 1e-133 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 379 / 2e-133 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 377 / 1e-132 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 377 / 2e-132 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10023221 373 / 1e-130 AT3G23730 376 / 4e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G146100 434 / 2e-155 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 424 / 4e-151 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201200 415 / 2e-147 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 414 / 4e-147 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 404 / 4e-143 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 390 / 9e-138 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.011G077320 389 / 4e-137 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.013G005700 381 / 2e-133 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 374 / 1e-131 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 371 / 2e-130 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10028947 pacid=23177197 polypeptide=Lus10028947 locus=Lus10028947.g ID=Lus10028947.BGIv1.0 annot-version=v1.0
ATGGCGACAACGGCTGCTGGTTTAGCTTTGTTAGTACTATGCATGACGATGGGCACGGCCTTCGGCGGGAACTTCTACGACGAGTTTGATCTAACTTGGG
GTGGGGACAGAGCCAGGATATTCGGCGCCGGGAACGGCCAGATGCTGTCTTTGTCTCTGGATAAGGCGTCCGGGTCAGGGTTCCGGTCGAAGAAGGAGTA
CTTGTTCGGGAGGATTGATGTTCAGCTCAAGCTCGTCACCGGTAACTCTGCTGGCACCGTTACGGCTTACTATTTGTCATCACAAGGACCGACTCACGAC
GAGATCGATTTCGAGTTCTTAGGGAACCTAAGTGGAGACCCGTACACATTACATACGAACGTGTTCACCCAAGGCAAAGGAAACAGAGAGCAACAATTCC
ACCTGTGGTTCGACCCGACCAAGAACTTCCACACTTACTCTATCGTATGGAAGCCTCAACACATCATATTCTTGGTGGACAACATCCCGATCAGGGTATT
CAAGAACGTCGAAAAGTTGGGAGTTCCATTCCCAAAGAGCCAACCTATGAGGATTTACTCCAGCCTATGGAACGCCGACGACTGGGCGACGCGTGGTGGT
TTGGTGAAGACCGATTGGTCGAAAGCTCCGTTCACTGCCTACTACAGAAACTTCCAGGCTACCCATTTGTCGTCGTCGACCAACTCCGTCCCCAGTGGCG
ATTGGGAATCCAACGAACTGAATGCCAATGGCCGAAGGCGGCTGCGATGGGTTCAGAGATATTTCATGGTTTACAATTACTGTGCTGACTCCAAACGCTT
CCCTCAAGGCTTTCCTGTTGAGTGTAAAGGCTCAAGATTCTGA
AA sequence
>Lus10028947 pacid=23177197 polypeptide=Lus10028947 locus=Lus10028947.g ID=Lus10028947.BGIv1.0 annot-version=v1.0
MATTAAGLALLVLCMTMGTAFGGNFYDEFDLTWGGDRARIFGAGNGQMLSLSLDKASGSGFRSKKEYLFGRIDVQLKLVTGNSAGTVTAYYLSSQGPTHD
EIDFEFLGNLSGDPYTLHTNVFTQGKGNREQQFHLWFDPTKNFHTYSIVWKPQHIIFLVDNIPIRVFKNVEKLGVPFPKSQPMRIYSSLWNADDWATRGG
LVKTDWSKAPFTAYYRNFQATHLSSSTNSVPSGDWESNELNANGRRRLRWVQRYFMVYNYCADSKRFPQGFPVECKGSRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Lus10028947 0 1
AT2G03210 ATFUT2, FUT2 fucosyltransferase 2 (.1) Lus10008693 13.6 0.8542
AT1G72310 ATL3 RING/U-box superfamily protein... Lus10019686 13.9 0.8993
AT1G17860 Kunitz family trypsin and prot... Lus10011090 22.5 0.8918
AT3G26270 CYP71B25 "cytochrome P450, family 71, s... Lus10019463 25.0 0.8866
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10043313 34.1 0.8887
AT1G10140 Uncharacterised conserved prot... Lus10007729 35.8 0.8777
AT2G38640 Protein of unknown function (D... Lus10007423 38.3 0.8802
AT3G48310 CYP71A22 "cytochrome P450, family 71, s... Lus10019462 39.9 0.8729
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10013332 57.9 0.8768
AT2G41480 Peroxidase superfamily protein... Lus10020826 62.9 0.8619

Lus10028947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.