Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028961 [exp] 118 / 2e-32 AT4G12560 81 / 2e-16 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10007485 [exp] 71 / 4e-15 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028962 pacid=23177116 polypeptide=Lus10028962 locus=Lus10028962.g ID=Lus10028962.BGIv1.0 annot-version=v1.0 ATGCCTTCCCCGATATCATTCTATGGAATCCGGCGACCTCCGAAACCAAGTTTCTGCCGCCTCTCCCTCCACATCGTCCCCGGAAACGGTGATGATGATG ATGTTGATCATAATGCTCCGCTTTCACTTGTTCATACCCAGAAAGATGCTACATTTATCTGCTCGCATGAACTGTATAGAGTCACAACTGCTGATCCTGC CGCCAAAGAAGTTGATGGAGTTTTCTGCCTTGATCTCTCTACCGGTGAAATCGTCCGCAATCGTCTCAAAATTCAAAGCACCGTTCAGCCTTTCGTCGCT CATACTTTTACTCCAACTCGAGTATTGATCGCTCAGCTTAGTAGTCCTCAGCCGCATTGA
AA sequence Show only first row Show all	>Lus10028962 pacid=23177116 polypeptide=Lus10028962 locus=Lus10028962.g ID=Lus10028962.BGIv1.0 annot-version=v1.0 MPSPISFYGIRRPPKPSFCRLSLHIVPGNGDDDDVDHNAPLSLVHTQKDATFICSHELYRVTTADPAAKEVDGVFCLDLSTGEIVRNRLKIQSTVQPFVA HTFTPTRVLIAQLSSPQPH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10028962 [exp]	0	1
AT5G19875			unknown protein		Lus10024507 [exp]	5.0	0.7427
AT4G02070		ATMSH6, MSH6-1	MUTS HOMOLOG 6-1, ARABIDOPSIS...		Lus10025030 [exp]	9.2	0.6262
AT3G22490			Seed maturation protein (.1)		Lus10010553 [exp]	16.7	0.6500
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10038560 [exp]	22.4	0.7104
					Lus10033100 [exp]	27.2	0.6685
AT3G05710		ATSYP43, SYP43	syntaxin of plants 43 (.1.2)		Lus10020683 [exp]	41.9	0.6750
					Lus10031358 [exp]	45.3	0.6147
AT2G06090			Plant self-incompatibility pro...		Lus10023196 [exp]	51.2	0.6219
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10036939 [exp]	94.3	0.6439

Compare expression of checked genes

Lus10028962 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.