Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16695 86 / 1e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007491 [exp] 105 / 3e-32 AT4G16695 86 / 1e-24 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G078100 [exp] 93 / 2e-27 AT4G16695 89 / 1e-25 unknown protein Potri.001G156500 [exp] 88 / 2e-25 AT4G16695 83 / 2e-23 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028968 pacid=23177171 polypeptide=Lus10028968 locus=Lus10028968.g ID=Lus10028968.BGIv1.0 annot-version=v1.0 ATGCCTCATCTGAGAATCGTCGAGGTCGAGCCACCTAGTCCGATCAGATACCTCATCGGCGCGGCGATTATGATGATCGGAGTGGTTTTTCCGGTCGGAT ACATGATGTTCCGCAACAAGCGAGTCCCTTCTTCTTCTTCTTACTCCAAACAGACGTAG
AA sequence Show only first row Show all	>Lus10028968 pacid=23177171 polypeptide=Lus10028968 locus=Lus10028968.g ID=Lus10028968.BGIv1.0 annot-version=v1.0 MPHLRIVEVEPPSPIRYLIGAAIMMIGVVFPVGYMMFRNKRVPSSSSYSKQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16695			unknown protein		Lus10028968 [exp]	0	1
AT5G24580			Heavy metal transport/detoxifi...		Lus10032923 [exp]	1.7	0.8695
AT1G53840		ATPME1	pectin methylesterase 1 (.1)		Lus10026435 [exp]	3.6	0.7817
AT5G24580			Heavy metal transport/detoxifi...		Lus10015583 [exp]	5.3	0.8135
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10040745 [exp]	6.8	0.8224
AT3G01390		AVMA10, VMA10	vacuolar membrane ATPase 10 (....		Lus10029418 [exp]	11.0	0.7669
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Lus10008615 [exp]	11.2	0.8198
AT5G56750		NDL1	N-MYC downregulated-like 1 (.1...		Lus10001786 [exp]	15.4	0.7730
AT1G12840		ATVHA-C, DET3	DE-ETIOLATED 3, ARABIDOPSIS TH...		Lus10031990 [exp]	20.0	0.7721
					Lus10011339 [exp]	21.1	0.8132
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Lus10037519 [exp]	22.6	0.8107

Compare expression of checked genes

Lus10028968 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.