Lus10028981 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028982 177 / 2e-57 ND /
Lus10007507 110 / 1e-31 ND /
Lus10007508 103 / 1e-29 ND /
Lus10011040 55 / 3e-10 AT3G21940 38 / 8e-04 Receptor protein kinase-related (.1)
Lus10002371 53 / 1e-09 AT4G38830 37 / 0.001 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
Lus10007505 50 / 8e-08 ND 39 / 0.002
Lus10042124 50 / 9e-08 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1)
Lus10007506 47 / 3e-07 AT3G22040 39 / 5e-04 Domain of unknown function (DUF26) (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10028981 pacid=23177245 polypeptide=Lus10028981 locus=Lus10028981.g ID=Lus10028981.BGIv1.0 annot-version=v1.0
ATGGGTCGTCGACGCTTGGAGCTTGCAACAACAACAACAGCAATAACGGCAGCCGTCGGATTCATCATCGTCGTGGTCGCGCTGTTTGGGATACGAGCCA
AGGCCGAGTACGATAAAGTTTTTTATTACCGATGTAACACGACAAAGTTCGACACAGTGAAAGACACGGAACTAGCTAATGACGCCAGGATATTTATCAA
CGCGCTCAGCGATGGTATCTCATACGGTTACGAACCGGCGAACCGCGACCGGTTAATTCCTTATGGTCAGGACGGGTCGTTTATCCATACTTGGGTACAC
TGTAGATCTTCTGAGATATGCCCGGTCTGTCTCCCAGCTGTTGCATTGACGACGATCCAAAATTGTAACAACTGTTACGGAGTGGACTTCCAGAATGACG
ATTGCGAGATCAGGTACGAGACTTACCCATTTTAG
AA sequence
>Lus10028981 pacid=23177245 polypeptide=Lus10028981 locus=Lus10028981.g ID=Lus10028981.BGIv1.0 annot-version=v1.0
MGRRRLELATTTTAITAAVGFIIVVVALFGIRAKAEYDKVFYYRCNTTKFDTVKDTELANDARIFINALSDGISYGYEPANRDRLIPYGQDGSFIHTWVH
CRSSEICPVCLPAVALTTIQNCNNCYGVDFQNDDCEIRYETYPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10028981 0 1
AT4G16195 Plant self-incompatibility pro... Lus10017929 3.5 0.8001
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10016168 4.9 0.8001
Lus10034545 6.0 0.8001
AT5G67090 Subtilisin-like serine endopep... Lus10002044 6.9 0.8001
AT1G29430 SAUR-like auxin-responsive pro... Lus10007059 7.7 0.8001
AT3G08720 ATPK2, ATPK19, ... ARABIDOPSIS THALIANA SERINE/TH... Lus10022732 7.9 0.6947
AT1G08790 Protein of unknown function (D... Lus10042536 8.5 0.7254
AT5G08020 ATRPA70B ARABIDOPSIS THALIANA RPA70-KDA... Lus10042979 10.5 0.6496
AT1G17615 Disease resistance protein (TI... Lus10018023 12.0 0.6342
AT3G18180 Glycosyltransferase family 61 ... Lus10032459 12.0 0.5726

Lus10028981 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.