Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11100 76 / 8e-18 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G58630 75 / 5e-17 Trihelix sequence-specific DNA binding transcription factors (.1) AT5G05550 73 / 1e-16 Trihelix sequence-specific DNA binding transcription factors (.1.2) AT3G14180 74 / 2e-16 Trihelix ASIL2 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) AT1G54060 71 / 1e-15 Trihelix ASIL1 6B-interacting protein 1-like 1 (.1) AT3G54390 46 / 1e-06 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G10030 42 / 4e-05 Trihelix aspartate/glutamate/uridylate kinase family protein (.1.2) AT3G24490 40 / 0.0001 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) AT2G44730 40 / 0.0002 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007273 [exp] 82 / 1e-19 AT3G14180 200 / 4e-62 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10015282 [exp] 77 / 8e-19 AT3G58630 140 / 3e-41 sequence-specific DNA binding transcription factors (.1) Lus10025406 [exp] 79 / 1e-18 AT3G14180 202 / 3e-63 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10025404 [exp] 78 / 3e-18 AT3G14180 197 / 1e-61 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10008141 [exp] 77 / 2e-17 AT3G14180 271 / 3e-87 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10020652 [exp] 76 / 5e-17 AT5G16860 344 / 2e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013179 [exp] 75 / 9e-17 AT3G14180 256 / 5e-81 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10025772 [exp] 46 / 9e-07 AT3G24490 223 / 3e-70 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10040141 [exp] 45 / 4e-06 AT2G44730 123 / 1e-31 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G071300 [exp] 87 / 7e-22 AT5G05550 209 / 3e-67 sequence-specific DNA binding transcription factors (.1.2) Potri.003G118600 [exp] 78 / 2e-18 AT3G58630 139 / 5e-39 sequence-specific DNA binding transcription factors (.1) Potri.001G113600 [exp] 78 / 4e-18 AT3G58630 138 / 1e-38 sequence-specific DNA binding transcription factors (.1) Potri.T126206 [exp] 72 / 7e-16 AT3G14180 173 / 9e-50 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.001G026000 [exp] 71 / 3e-15 AT3G14180 186 / 1e-54 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.003G200000 [exp] 70 / 3e-15 AT3G14180 172 / 2e-49 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.010G186200 [exp] 61 / 3e-12 AT5G05550 149 / 3e-44 sequence-specific DNA binding transcription factors (.1.2) Potri.014G051200 [exp] 56 / 3e-10 AT2G44730 239 / 3e-76 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.002G139500 [exp] 54 / 2e-09 AT2G44730 252 / 3e-81 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.008G027000 [exp] 47 / 5e-07 AT3G10030 457 / 2e-157 aspartate/glutamate/uridylate kinase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028984 pacid=23177265 polypeptide=Lus10028984 locus=Lus10028984.g ID=Lus10028984.BGIv1.0 annot-version=v1.0 ATGGACCCCTCAACTTCCCGGGGAGGACACTCCCGCAGCGGCGGCGGCGGCGGAGGAGGACGAGAAGACTGCTGGAGCGAAGGCGCGACCGAGTCCTTAG TCGAAGCATGGGGTGATCGCTACGTCAGCGTAAAAAATGGCACCCTCCGCCAGAAGGACTGGAAGGAAGTCGCCGACGCGGTCAACGCTCGGCGGAGCGC CGCCGGTAAACCGCCGAGGACGGACCTCCACTGTAAGGGAGATCCGTCCTCCACAGGGTCGAACCGTTATCGAATTCGACTTCAGAAGGAGGAACCAGCA GCTCGTCCGGCGGCGGCGGCGAAGGAGATGCAGGGTTCAATGAGAGGGTTGTGA
AA sequence Show only first row Show all	>Lus10028984 pacid=23177265 polypeptide=Lus10028984 locus=Lus10028984.g ID=Lus10028984.BGIv1.0 annot-version=v1.0 MDPSTSRGGHSRSGGGGGGGREDCWSEGATESLVEAWGDRYVSVKNGTLRQKDWKEVADAVNARRSAAGKPPRTDLHCKGDPSSTGSNRYRIRLQKEEPA ARPAAAAKEMQGSMRGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14180	Trihelix	ASIL2	Arabidopsis 6B-interacting pr...		Lus10028984 [exp]	0	1
AT4G39910		ATUBP3	ubiquitin-specific protease 3 ...		Lus10024043 [exp]	5.0	0.8884
AT1G11480			eukaryotic translation initiat...		Lus10039708 [exp]	8.1	0.8905
AT1G25280	TUB	AtTLP10	tubby like protein 10 (.1.2.3)		Lus10034106 [exp]	9.8	0.8607
AT5G23450		ATLCBK1	long-chain base (LCB) kinase 1...		Lus10017366 [exp]	9.9	0.8839
AT1G11300			protein serine/threonine kinas...		Lus10039731 [exp]	11.7	0.9004
AT1G04300			TRAF-like superfamily protein ...		Lus10021218 [exp]	16.6	0.8648
AT3G19080			SWIB complex BAF60b domain-con...		Lus10009333 [exp]	19.3	0.8971
AT5G15130	WRKY	ATWRKY72, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10036725 [exp]	21.2	0.8886
AT1G10140			Uncharacterised conserved prot...		Lus10007729 [exp]	24.2	0.8808
AT4G28610	GARP	ATPHR1, PHR1	phosphate starvation response ...		Lus10022885 [exp]	26.5	0.8476

Compare expression of checked genes

Lus10028984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.