Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05550 96 / 4e-25 Trihelix sequence-specific DNA binding transcription factors (.1.2) AT3G11100 90 / 7e-23 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G58630 67 / 6e-14 Trihelix sequence-specific DNA binding transcription factors (.1) AT3G14180 67 / 9e-14 Trihelix ASIL2 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) AT1G54060 57 / 2e-10 Trihelix ASIL1 6B-interacting protein 1-like 1 (.1) AT3G24490 47 / 8e-07 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025406 [exp] 79 / 2e-18 AT3G14180 202 / 3e-63 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10015281 [exp] 75 / 6e-18 AT3G58630 79 / 2e-18 sequence-specific DNA binding transcription factors (.1) Lus10025404 [exp] 75 / 4e-17 AT3G14180 197 / 1e-61 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10029220 [exp] 68 / 8e-16 AT3G14180 74 / 4e-17 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10007273 [exp] 72 / 9e-16 AT3G14180 200 / 4e-62 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10029889 [exp] 62 / 3e-12 AT3G14180 147 / 1e-40 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Lus10035893 [exp] 62 / 4e-12 AT3G24490 214 / 1e-66 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10025772 [exp] 60 / 3e-11 AT3G24490 223 / 3e-70 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10008141 [exp] 58 / 1e-10 AT3G14180 271 / 3e-87 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G071300 [exp] 124 / 8e-36 AT5G05550 209 / 3e-67 sequence-specific DNA binding transcription factors (.1.2) Potri.010G186200 [exp] 119 / 3e-34 AT5G05550 149 / 3e-44 sequence-specific DNA binding transcription factors (.1.2) Potri.001G113600 [exp] 75 / 7e-17 AT3G58630 138 / 1e-38 sequence-specific DNA binding transcription factors (.1) Potri.003G118600 [exp] 75 / 7e-17 AT3G58630 139 / 5e-39 sequence-specific DNA binding transcription factors (.1) Potri.003G200000 [exp] 68 / 2e-14 AT3G14180 172 / 2e-49 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.T126206 [exp] 68 / 2e-14 AT3G14180 173 / 9e-50 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.001G026000 [exp] 66 / 3e-13 AT3G14180 186 / 1e-54 Arabidopsis 6B-interacting protein 1-like 2, sequence-specific DNA binding transcription factors (.1) Potri.001G179800 [exp] 57 / 3e-10 AT3G24490 206 / 2e-63 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.003G056000 [exp] 56 / 6e-10 AT3G24490 205 / 8e-63 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.018G075500 [exp] 52 / 1e-08 AT3G24490 252 / 1e-81 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10028985 pacid=23177200 polypeptide=Lus10028985 locus=Lus10028985.g ID=Lus10028985.BGIv1.0 annot-version=v1.0 ATGGAGGACGTGAGCGGCTCCGACGGAGCTGCTTGTAAGGAATTGGCGAGGGCGATACTGAAATTCGCGGAGATTTACGAGAAAGTCGAGAGCTTGAAGC AGAAGCAGATGGTGGAGCTGGAGAAGCAGAGGATGGAGTTCACTAAAGAGCTCGAATTTGAGAGGATGAACATGTTCATGGCTGCCCAATTGGACATGAA GAAGAAGAAGTCGTTTAAACGGCAGAAAGTCGCTTCTGGATCAGTCAACTTAGATGCTGCAAATGGTGATGCTAACTTGATTTACTTCCAGGTGGAGAGT AATGCCTGCAAATCTGGATGCTATTTAGGAACCAAGTCGACTCTTTTTTCTGAATCGGGGAGAGCTTTCACGTTTCCAAACTCGTCTGTCGCATGA
AA sequence Show only first row Show all	>Lus10028985 pacid=23177200 polypeptide=Lus10028985 locus=Lus10028985.g ID=Lus10028985.BGIv1.0 annot-version=v1.0 MEDVSGSDGAACKELARAILKFAEIYEKVESLKQKQMVELEKQRMEFTKELEFERMNMFMAAQLDMKKKKSFKRQKVASGSVNLDAANGDANLIYFQVES NACKSGCYLGTKSTLFSESGRAFTFPNSSVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05550	Trihelix		sequence-specific DNA binding ...		Lus10028985 [exp]	0	1
AT5G37850		SOS4, ATSOS4	SALT OVERLY SENSITIVE 4, pfkB-...		Lus10000451 [exp]	1.0	0.9498
AT5G07360			Amidase family protein (.1.2)		Lus10032519 [exp]	2.8	0.9287
AT4G36740	HD	HB-5, ATHB40	homeobox protein 40 (.1)		Lus10041719 [exp]	9.5	0.9249
AT4G18360			Aldolase-type TIM barrel famil...		Lus10023302 [exp]	10.5	0.9410
AT1G11380			PLAC8 family protein (.1)		Lus10002586 [exp]	10.8	0.9293
AT1G34780		ATAPRL4	APR-like 4 (.1.2)		Lus10036486 [exp]	13.4	0.9224
AT1G21770			Acyl-CoA N-acyltransferases (N...		Lus10025670 [exp]	13.5	0.9094
AT3G53820	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10024363 [exp]	14.8	0.9171
AT1G03590			Protein phosphatase 2C family ...		Lus10033708 [exp]	16.1	0.9218
AT2G48010		RKF3	receptor-like kinase in in flo...		Lus10029626 [exp]	16.7	0.9152

Compare expression of checked genes

Lus10028985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.