Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11090 185 / 9e-61 AS2 LBD21 LOB domain-containing protein 21 (.1) AT3G27650 158 / 3e-50 AS2 LBD25 LOB domain-containing protein 25 (.1) AT5G63090 146 / 3e-45 AS2 LOBB, LOB Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT2G30130 145 / 6e-45 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT5G66870 146 / 1e-43 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) AT2G23660 140 / 2e-41 AS2 LBD10 LOB domain-containing protein 10 (.1.2) AT1G16530 133 / 2e-40 AS2 ASL9, LBD3 LOB DOMAIN-CONTAINING PROTEIN 3, ASYMMETRIC LEAVES 2-like 9 (.1) AT1G65620 134 / 3e-40 AS2 AS2 ASYMMETRIC LEAVES 2, Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT2G30340 134 / 2e-39 AS2 LBD13 LOB domain-containing protein 13 (.1) AT1G07900 130 / 5e-39 AS2 LBD1 LOB domain-containing protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005313 [exp] 158 / 2e-49 AT5G66870 209 / 4e-67 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) Lus10031285 [exp] 148 / 5e-46 AT2G30130 226 / 3e-76 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10022264 [exp] 148 / 7e-46 AT5G63090 223 / 9e-75 Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) Lus10027676 [exp] 147 / 1e-45 AT5G63090 233 / 8e-79 Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) Lus10022463 [exp] 150 / 2e-45 AT5G66870 221 / 8e-71 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) Lus10016769 [exp] 150 / 2e-45 AT5G66870 222 / 3e-71 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) Lus10031855 [exp] 145 / 4e-45 AT2G30130 220 / 4e-74 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10039940 [exp] 145 / 1e-44 AT5G63090 236 / 5e-80 Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) Lus10017431 [exp] 144 / 1e-44 AT2G30130 199 / 1e-65 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G186000 [exp] 221 / 5e-75 AT3G11090 178 / 7e-58 LOB domain-containing protein 21 (.1) Potri.008G071500 [exp] 213 / 1e-71 AT3G11090 174 / 4e-56 LOB domain-containing protein 21 (.1) Potri.001G345700 [exp] 153 / 4e-48 AT3G27650 208 / 5e-70 LOB domain-containing protein 25 (.1) Potri.015G082200 [exp] 149 / 3e-46 AT5G63090 223 / 4e-75 Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) Potri.005G134900 [exp] 150 / 1e-45 AT5G66870 254 / 8e-84 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) Potri.005G097800 [exp] 146 / 1e-45 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.007G066700 [exp] 146 / 1e-45 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.001G281600 [exp] 146 / 2e-45 AT2G30130 248 / 4e-85 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.008G072800 [exp] 146 / 3e-45 AT2G30130 229 / 8e-78 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.012G083500 [exp] 146 / 3e-45 AT5G63090 223 / 4e-75 Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10028986 pacid=23177232 polypeptide=Lus10028986 locus=Lus10028986.g ID=Lus10028986.BGIv1.0 annot-version=v1.0 ATGAAAAGCCACCACGAGCCAAGATCAAGCTCTTCATGCGCAGCCTGCAAGTTCCTCAAGAGAAGATGCACTTCTAACTGCATCTTCGCCCCTTACTTCC GGTCCGACGAGCCCAAAAAGTTTGCCAAAGTCCACAAAGTCTTCGGCGCAAGCAACGTGAGCAAGATCCTGACAGAGGTCCCCGAAGAGCAGCGAGAAGA CACCGTGAATTCCCTGGCCTACGAGGCCGAGGCCAGGCTAGTGGACCCTGTCTACGGCTGCATTGGCGCCATAGCCATGCTCCAGCGAAAGATGGTCGAG CTCCAGGTTGATCTCGCCATTGCCAGAGCTCGCCTCCTTCGCTGTACTTCCGCTCCCACTGGTGAGATCGGTACTACATTCGGCGAGTTCCCCTCAATGA TCGACGGATTCGAGCAAGAAGTACCACTACCCATCAGTGATTTCAGTCAGTTTCCTTATATATTCTGA
AA sequence Show only first row Show all	>Lus10028986 pacid=23177232 polypeptide=Lus10028986 locus=Lus10028986.g ID=Lus10028986.BGIv1.0 annot-version=v1.0 MKSHHEPRSSSSCAACKFLKRRCTSNCIFAPYFRSDEPKKFAKVHKVFGASNVSKILTEVPEEQREDTVNSLAYEAEARLVDPVYGCIGAIAMLQRKMVE LQVDLAIARARLLRCTSAPTGEIGTTFGEFPSMIDGFEQEVPLPISDFSQFPYIF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11090	AS2	LBD21	LOB domain-containing protein ...		Lus10028986 [exp]	0	1
AT3G03220		ATHEXPALPHA1.22...	EXPANSIN 13, expansin A13 (.1)		Lus10003822 [exp]	3.0	0.8268
AT5G03680	Trihelix	PTL	PETAL LOSS, Duplicated homeodo...		Lus10035570 [exp]	5.3	0.8058
AT1G49850			RING/U-box superfamily protein...		Lus10002113 [exp]	6.2	0.8100
AT1G23380	HD	KNAT6S, KNAT6L,...	KNOTTED1-like homeobox gene 6 ...		Lus10013037 [exp]	11.9	0.8067
AT5G56270	WRKY	ATWRKY2, WRKY2,...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10020215 [exp]	15.7	0.7965
AT1G47270	TUB	AtTLP6	tubby like protein 6 (.1.2)		Lus10010833 [exp]	16.3	0.7536
AT1G21090			Cupredoxin superfamily protein...		Lus10018856 [exp]	17.9	0.7882
AT5G03680	Trihelix	PTL	PETAL LOSS, Duplicated homeodo...		Lus10027718 [exp]	18.0	0.7769
AT1G64620	DOF	AtDof1,8	Dof-type zinc finger DNA-bindi...		Lus10033218 [exp]	19.2	0.7755
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10027507 [exp]	19.5	0.7691

Compare expression of checked genes

Lus10028986 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.