Lus10028996 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25570 124 / 6e-35 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 107 / 1e-28 ACYB-1 cytochrome B561-1 (.1)
AT1G14730 105 / 5e-28 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G26100 99 / 2e-25 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003682 328 / 4e-115 AT4G25570 131 / 1e-37 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034427 134 / 8e-39 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10039216 134 / 1e-38 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 120 / 1e-33 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 112 / 2e-30 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 112 / 1e-29 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10027461 109 / 8e-29 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 81 / 6e-19 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10021715 82 / 9e-19 AT1G26100 241 / 3e-80 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G102400 139 / 7e-41 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 124 / 5e-35 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 122 / 3e-34 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 120 / 8e-34 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.004G103800 111 / 3e-30 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 108 / 4e-29 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.017G111700 102 / 9e-27 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.010G131100 92 / 9e-23 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 89 / 1e-21 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10028996 pacid=23151867 polypeptide=Lus10028996 locus=Lus10028996.g ID=Lus10028996.BGIv1.0 annot-version=v1.0
ATGAGAGGGATGCAGATCTCGGCGTTACCGGTAACGGTGATGGCGCACTTGATAGCCATTGCTACGACGATCCTCGTCCTCGTCTGGCTCCTCAAGCTCC
GAGATGGCCTCTCTTGGAGCATCGACCCCATCCCCAACAAAGCTTTTAACGTGCATCCTCTGGTAATGGTGATTGGATTTATAATCATATCAGGAGAAGG
AATAATGGCATATAAGACGGTGAGAGGCCAGAGAAGAACGGTTCGGAAAGTGACTCATTTGGTTCTTCAGAGTGTAGCTATGGTGGCGGCAGTGTTTGGG
GTGGTTGTGGTTTTTAGGTTCAACCACCTGATTCACTCTCCACACATGATCACTCTCCATTCCTGGCTTGGCATCATCACTGTTTCCTTGTTTGGTTTGC
AGTTTGTGCTAGGGGCGGGGTTCTACATGTTCAAAGGGACAAAGATGCCGGCGAAGGCGTCGTATCTCCCGTGGCATGTCTTCCTCGGGAGCATCGTATT
CCTGCTGGCGATTGCGACAGCCCTGACCGGCATAGTCCGGCAATTTGGAATCCTAGGACTTGGTCGCACCCAAGAGGGCCTCATCGTCAACTTCATCGGA
CTTTTACTTGTTCTTTACGCCGTCGCCGTCGGACTCGCTGTTTCTCTCCCGTATGAGAGGTGA
AA sequence
>Lus10028996 pacid=23151867 polypeptide=Lus10028996 locus=Lus10028996.g ID=Lus10028996.BGIv1.0 annot-version=v1.0
MRGMQISALPVTVMAHLIAIATTILVLVWLLKLRDGLSWSIDPIPNKAFNVHPLVMVIGFIIISGEGIMAYKTVRGQRRTVRKVTHLVLQSVAMVAAVFG
VVVVFRFNHLIHSPHMITLHSWLGIITVSLFGLQFVLGAGFYMFKGTKMPAKASYLPWHVFLGSIVFLLAIATALTGIVRQFGILGLGRTQEGLIVNFIG
LLLVLYAVAVGLAVSLPYER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10028996 0 1
Lus10000377 1.0 0.9201
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10014880 2.0 0.9149
AT3G15510 NAC ATNAC2, ANAC056... NAC-REGULATED SEED MORPHOLOGY ... Lus10007410 4.2 0.8170
AT3G26210 CYP71B23 "cytochrome P450, family 71, s... Lus10017678 5.3 0.6777
Lus10039418 5.8 0.8449
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10024816 6.2 0.9130
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10033877 6.8 0.7367
Lus10023005 6.9 0.8519
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 7.5 0.9035
Lus10023004 8.1 0.7608

Lus10028996 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.