Plant FIBer expression Database

Lus10029009 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08710 126 / 4e-38 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
AT3G51030 109 / 9e-32 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
AT3G56420 110 / 1e-31 Thioredoxin superfamily protein (.1)
AT2G40790 104 / 4e-29 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1)
AT1G45145 89 / 9e-24 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1)
AT5G39950 89 / 1e-23 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
AT1G19730 86 / 2e-22 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1)
AT5G42980 86 / 3e-22 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
AT3G17880 90 / 5e-22 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
AT1G11530 72 / 9e-17 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029090
[exp]
219 / 2e-74 AT3G08710 114 / 2e-33 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Lus10012859
[exp]
211 / 5e-71 AT3G08710 134 / 9e-41 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Lus10030505
[exp]
208 / 2e-69 AT3G08710 132 / 8e-40 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Lus10014186
[exp]
136 / 7e-42 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Lus10022727
[exp]
134 / 3e-41 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Lus10041799
[exp]
109 / 2e-31 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Lus10028349
[exp]
107 / 8e-31 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Lus10014277
[exp]
104 / 2e-29 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Lus10024293
[exp]
94 / 2e-25 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G110100
[exp]
150 / 2e-47 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Potri.016G138800
[exp]
149 / 4e-47 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Potri.019G062000
[exp]
146 / 1e-45 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Potri.007G018000
[exp]
106 / 2e-30 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Potri.005G232700
[exp]
105 / 3e-30 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Potri.002G030000
[exp]
101 / 3e-28 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Potri.012G045000
[exp]
92 / 1e-22 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
Potri.015G036000
[exp]
92 / 2e-22 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
Potri.008G194100
[exp]
80 / 1e-19 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1)
Potri.017G076700
[exp]
75 / 7e-18 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10029009 pacid=23151706 polypeptide=Lus10029009 locus=Lus10029009.g ID=Lus10029009.BGIv1.0 annot-version=v1.0
ATGTTCGGCCGTTGTTACTCCAATCTAAGGTGTTGCAAGGGAGCGAAAGGTGGCCGCGGGGCCCACAACCATGACGAAAGTCAAACAAACGCCCATGTAG
AACTCGCAACGGGGAGAGTCCATCTGATCAACACGATCACGAATTGGGAAGCCAGCCTCCAAGAATCGAAGGAGCCCGGAAAGATCGTGATCGTCAACTT
CAGCTCCTCGTGGAGTGGTCCTTGCCGGAGTATAGCACGGCCATACTGCAAGCTGGCCGACAAGTACCCTTCCATCACGTTCCTAACGGTGGACGCGGAT
GAACTCGCAGAGATGAGCTCGACGTGGGAAGTGAAGGCTACGCCGACGTTCTTCTTCTTGAGAGAAGGGAAGTTGGTAGATAAACACGTTGGTGCCGATA
AGGTTGAGCTCAAGACCAAGATTGCTAACATCGATAGTCTACCGTTACAATAG
AA sequence
>Lus10029009 pacid=23151706 polypeptide=Lus10029009 locus=Lus10029009.g ID=Lus10029009.BGIv1.0 annot-version=v1.0
MFGRCYSNLRCCKGAKGGRGAHNHDESQTNAHVELATGRVHLINTITNWEASLQESKEPGKIVIVNFSSSWSGPCRSIARPYCKLADKYPSITFLTVDAD
ELAEMSSTWEVKATPTFFFLREGKLVDKHVGADKVELKTKIANIDSLPLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10029009
[exp]
0 1

Lus10029009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.