Lus10029015 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05220 77 / 1e-18 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034248 241 / 7e-84 AT5G05220 85 / 2e-21 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G090200 96 / 4e-26 AT5G05220 75 / 2e-17 unknown protein
PFAM info
Representative CDS sequence
>Lus10029015 pacid=23151731 polypeptide=Lus10029015 locus=Lus10029015.g ID=Lus10029015.BGIv1.0 annot-version=v1.0
ATGGGAACTTTCTGCTTCGTTTCTTACCCTGCAGCTTCATCTCCAACCATCAACGCCTCTCTTCCCCCTTCAAGATCCAACCTTTATCCACCTGCAACTC
AACTAATCCTCCCAACAAGAAGGAAATTGCATCTCAATTGTGCCAAGCTGAGCCCTCCAATGTCTCACTACCAAGATCATGAACAAGAGTGGATGGATGT
GGAATTTGGGAAGCTGGTGAAGGAGAAGTGCAGAGAAAGGAAAGGAGTGGTGGAGCTGTTGGAATGCCTTGAGACTGAAGCAATCATGGGCGATGATGAA
GGTAAAGATCCTACTGATTATAATCGCAGAGCACAGATCTTTGACAGAAGCTCCATAGTTTTCCAGTCTCTCAAGAACCAGCAAAACCAGCCATAA
AA sequence
>Lus10029015 pacid=23151731 polypeptide=Lus10029015 locus=Lus10029015.g ID=Lus10029015.BGIv1.0 annot-version=v1.0
MGTFCFVSYPAASSPTINASLPPSRSNLYPPATQLILPTRRKLHLNCAKLSPPMSHYQDHEQEWMDVEFGKLVKEKCRERKGVVELLECLETEAIMGDDE
GKDPTDYNRRAQIFDRSSIVFQSLKNQQNQP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05220 unknown protein Lus10029015 0 1
AT1G07360 C3HZnF MAC5A MOS4-associated complex subuni... Lus10012448 4.2 0.7082
AT4G19770 Glycosyl hydrolase family prot... Lus10003408 10.8 0.6839
Lus10031183 17.2 0.6816
AT1G21150 Mitochondrial transcription te... Lus10039174 18.4 0.6790
Lus10021139 21.2 0.6780
Lus10021851 25.1 0.6773
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 27.1 0.6773
Lus10008791 29.0 0.6773
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10035637 29.3 0.6695
Lus10012440 30.7 0.6773

Lus10029015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.