Gene [FLAX] | FIBexDB

Lus10029017 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT2G38560	54 / 5e-09		RDO2, TFIIS	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
AT2G13640	40 / 0.0002			Transcription factor IIS family protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10034247 [exp]	211 / 3e-69	AT2G38560	295 / 1e-98	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Lus10014178 [exp]	65 / 5e-13	AT2G38560	384 / 1e-132	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Lus10022735 [exp]	64 / 1e-12	AT2G38560	375 / 2e-129	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Lus10025131 [exp]	58 / 2e-10	AT2G38560	387 / 6e-134	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Lus10025215 [exp]	57 / 4e-10	AT2G38560	384 / 8e-133	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.006G109300 [exp]	62 / 6e-12	AT2G38560	393 / 2e-136	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Potri.016G138100 [exp]	61 / 9e-12	AT2G38560	402 / 3e-140	REDUCED DORMANCY 2, transcript elongation factor IIS (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
		PF11467 [flax] [poplar]	LEDGF	Lens epithelium-derived growth factor (LEDGF)
		PF08711 [flax] [poplar]	Med26	TFIIS helical bundle-like domain

Representative CDS sequence

Show only first row Show all

>Lus10029017 pacid=23151875 polypeptide=Lus10029017 locus=Lus10029017.g ID=Lus10029017.BGIv1.0 annot-version=v1.0

ATGGGAAGCTCGAAAGAGGATGAGAAGCAAATGCTGGTGGAGCTGGTTCATGCAGCCAAGAAAGCAGGGGAAGGAACAGGGGAGGATTATTCCAGATGCT

TGGACGCTTTGAATCGCCTCAAGGAATTCACTGTCACCGTTCAATCCCTCGTCTCCACCCAGGTAGGGAAGCAGCTTCGGCCTCTGACGAAACACGCCAG

CAAGGACATCCAGAAGCTGGCCTCCGAAATCTTCCGAACATGGAAATCCATGTTCCTGGAGCAGTCCAAGAAGAATGTTGCGAAACCTTCGAAAAATTCT

GACAAGCTTCGCATTTTGACACCACCACCAATCAAGCCACAAACTCCAGACAGGAAGCTCAAATCCCCTGCATTGAGTCATCACTCCATGGTTGTGCCGA

AATGCAACGATCCCACGAGGGACAAGTGTTAA

AA sequence

Show only first row Show all

>Lus10029017 pacid=23151875 polypeptide=Lus10029017 locus=Lus10029017.g ID=Lus10029017.BGIv1.0 annot-version=v1.0

MGSSKEDEKQMLVELVHAAKKAGEGTGEDYSRCLDALNRLKEFTVTVQSLVSTQVGKQLRPLTKHASKDIQKLASEIFRTWKSMFLEQSKKNVAKPSKNS

DKLRILTPPPIKPQTPDRKLKSPALSHHSMVVPKCNDPTRDKC

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Lus10029017 [exp]	0	1

Lus10029017 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.