Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56380 97 / 2e-26 ARR17 response regulator 17 (.1) AT2G40670 91 / 4e-24 ARR16 response regulator 16 (.1.2) AT3G57040 84 / 1e-20 ATRR4, ARR9 RESPONSE REGULATOR 4, response regulator 9 (.1) AT2G41310 82 / 7e-20 ARR8, ATRR3 RESPONSE REGULATOR 8, response regulator 3 (.1) AT1G74890 79 / 4e-19 ARR15 response regulator 15 (.1) AT1G19050 78 / 1e-18 ARR7 response regulator 7 (.1) AT1G59940 77 / 7e-18 ARR3 response regulator 3 (.1) AT1G10470 76 / 3e-17 IBC7, ATRR1, ARR4, MEE7 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) AT3G48100 73 / 6e-17 ATRR2, IBC6, ARR5 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) AT5G62920 72 / 2e-16 ARR6 response regulator 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036642 [exp] 84 / 9e-21 AT1G19050 160 / 6e-50 response regulator 7 (.1) Lus10042938 [exp] 82 / 4e-20 AT1G19050 153 / 7e-47 response regulator 7 (.1) Lus10042153 [exp] 76 / 1e-17 AT3G48100 213 / 1e-70 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10010723 [exp] 76 / 2e-17 AT1G10470 155 / 1e-46 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10039524 [exp] 76 / 2e-17 AT3G57040 222 / 2e-73 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10004243 [exp] 74 / 7e-17 AT3G48100 220 / 2e-73 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10016334 [exp] 73 / 2e-16 AT3G57040 211 / 5e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10002750 [exp] 69 / 8e-15 AT3G57040 212 / 4e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10029211 [exp] 65 / 4e-13 AT1G10470 211 / 4e-68 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G058900 [exp] 100 / 1e-27 AT3G56380 223 / 5e-76 response regulator 17 (.1) Potri.019G133600 [exp] 93 / 4e-25 AT3G56380 183 / 2e-60 response regulator 17 (.1) Potri.T124806 [exp] 82 / 3e-20 AT2G41310 232 / 6e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.016G038000 [exp] 80 / 3e-19 AT2G41310 242 / 2e-81 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.006G041100 [exp] 80 / 5e-19 AT3G57040 273 / 4e-93 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.003G197466 [exp] 79 / 5e-19 AT2G41310 232 / 5e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.001G027000 [exp] 78 / 1e-18 AT2G41310 203 / 2e-66 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.015G070000 [exp] 76 / 1e-17 AT3G48100 231 / 1e-77 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Potri.010G037800 [exp] 71 / 1e-15 AT1G59940 202 / 5e-65 response regulator 3 (.1) Potri.002G082200 [exp] 70 / 3e-15 AT3G57040 180 / 1e-56 RESPONSE REGULATOR 4, response regulator 9 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029027 pacid=23151656 polypeptide=Lus10029027 locus=Lus10029027.g ID=Lus10029027.BGIv1.0 annot-version=v1.0 ATGGACGTCGGAAGCAGAGGAGTCGTCGTTGGGAATTCAACGTCCGATTATGCAGAGTCAATACATGTCCTGGCCGTCGATGACAACCTCGTCGAAAGGA AACTCCTGGAACGCCTCCTCAAAAACATCTCCTCTTGCACCGTGACAACCGCGGAAAACGGAGCGAAGGCGTTGGAGTATTTGGGGTTGCATCAAGACCA TGATGATGGGGATGTTGAATCGAGTGACTTGAAGGGAGTTCCGGTCGTGGTTGTTTCGTCTGAGAATATCCCGACCCGTGTCAATCAGTGTTTGAAGGAA GGAGCAGAGATGTTTATGGTGAAGCCATTGAAACAGTTGGATGTGAACAAGCTGATAATGGCACCTCGACTGATGACCAAGCAGTGCGAGGCCGATTCTT TCTGCTAA
AA sequence Show only first row Show all	>Lus10029027 pacid=23151656 polypeptide=Lus10029027 locus=Lus10029027.g ID=Lus10029027.BGIv1.0 annot-version=v1.0 MDVGSRGVVVGNSTSDYAESIHVLAVDDNLVERKLLERLLKNISSCTVTTAENGAKALEYLGLHQDHDDGDVESSDLKGVPVVVVSSENIPTRVNQCLKE GAEMFMVKPLKQLDVNKLIMAPRLMTKQCEADSFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G56380		ARR17	response regulator 17 (.1)		Lus10029027 [exp]	0	1
AT1G24420			HXXXD-type acyl-transferase fa...		Lus10036077 [exp]	1.4	0.8083
AT3G18970		MEF20	mitochondrial editing factor ...		Lus10006589 [exp]	7.1	0.8075
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036126 [exp]	11.5	0.7268
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10000319 [exp]	13.0	0.7340
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10026237 [exp]	13.4	0.7361
AT5G59530			2-oxoglutarate (2OG) and Fe(II...		Lus10041230 [exp]	15.7	0.6850
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10031674 [exp]	21.3	0.7423
AT4G25400	bHLH	bHLH118	basic helix-loop-helix (bHLH) ...		Lus10031675 [exp]	28.0	0.7912
					Lus10024160 [exp]	31.4	0.6429
AT5G04885			Glycosyl hydrolase family prot...		Lus10008434 [exp]	52.0	0.6327

Compare expression of checked genes

Lus10029027 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.