Lus10029042 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56340 130 / 4e-40 Ribosomal protein S26e family protein (.1)
AT2G40590 129 / 2e-39 Ribosomal protein S26e family protein (.1)
AT2G40510 129 / 2e-39 Ribosomal protein S26e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034223 162 / 2e-52 AT2G40510 182 / 2e-60 Ribosomal protein S26e family protein (.1)
Lus10030533 154 / 2e-49 AT2G40510 185 / 1e-61 Ribosomal protein S26e family protein (.1)
Lus10012883 159 / 3e-48 AT3G10920 356 / 1e-123 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G057000 143 / 5e-45 AT3G56340 132 / 6e-41 Ribosomal protein S26e family protein (.1)
Potri.013G093700 140 / 4e-44 AT3G56340 130 / 3e-40 Ribosomal protein S26e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01283 Ribosomal_S26e Ribosomal protein S26e
Representative CDS sequence
>Lus10029042 pacid=23151848 polypeptide=Lus10029042 locus=Lus10029042.g ID=Lus10029042.BGIv1.0 annot-version=v1.0
ATGCCTTTCAAGCGTAGGAACGGAGGTCGCAACAAGCAGGGACGCGGCCACACTAAGTTCATCCGCTGCTCCAACTGCGGAAAATGCTGCCCTAAGGACA
AGGCGATCAAGAGATTCCTTGTGAGGAACATTGTCGAGCAGGCTGCTGTTAGAGATGTTCAGGAATCATGCGTCTTTGACGGATATGTTCTCCCAAAGCT
TTATGTAAAGATGCAGTACTGCGTCTCATGTGCCATCCACTCTCGCGTTGTGAGGGTCCGATCAAGCACTGATCGCAGGAAGCGTGACCCACCCCAGCGT
TTCCAGAGGCGCAAGGAGGATGCTAAACCTGGTCAAGGTGGACCTGCTGGTCCCGGTGCTCGCCCTGGCGCTCCTCCAGTTGCTGCCCGTGCTTAA
AA sequence
>Lus10029042 pacid=23151848 polypeptide=Lus10029042 locus=Lus10029042.g ID=Lus10029042.BGIv1.0 annot-version=v1.0
MPFKRRNGGRNKQGRGHTKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQESCVFDGYVLPKLYVKMQYCVSCAIHSRVVRVRSSTDRRKRDPPQR
FQRRKEDAKPGQGGPAGPGARPGAPPVAARA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G40510 Ribosomal protein S26e family ... Lus10029042 0 1
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10004113 3.5 0.9126
AT5G18380 Ribosomal protein S5 domain 2-... Lus10034378 4.1 0.9132
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10040316 5.3 0.8935
AT5G43020 Leucine-rich repeat protein ki... Lus10024803 9.5 0.9035
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10035632 11.4 0.8804
AT5G48760 Ribosomal protein L13 family p... Lus10043151 16.5 0.8826
AT1G74050 Ribosomal protein L6 family pr... Lus10038776 16.7 0.8805
AT5G58930 Protein of unknown function (D... Lus10018206 17.2 0.8904
AT3G49910 Translation protein SH3-like f... Lus10011540 17.5 0.8684
AT4G34860 A/N-InvB alkaline/neutral invertase B, ... Lus10026284 17.9 0.8685

Lus10029042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.