Lus10029047 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G50310 94 / 3e-23 MKKK20, MAPKKK20 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
AT5G67080 92 / 1e-22 MAPKKK19 mitogen-activated protein kinase kinase kinase 19 (.1)
AT4G36950 86 / 1e-20 MAPKKK21 mitogen-activated protein kinase kinase kinase 21 (.1)
AT3G46140 86 / 5e-20 Protein kinase superfamily protein (.1)
AT5G55090 84 / 2e-19 MAPKKK15 mitogen-activated protein kinase kinase kinase 15 (.1)
AT3G06030 83 / 7e-19 AtANP3, MAPKKK12, ANP3 NPK1-related protein kinase 3 (.1)
AT4G26890 82 / 1e-18 MAPKKK16 mitogen-activated protein kinase kinase kinase 16 (.1)
AT2G32510 82 / 1e-18 MAPKKK17 mitogen-activated protein kinase kinase kinase 17 (.1)
AT2G42550 81 / 2e-18 Protein kinase superfamily protein (.1)
AT1G09000 80 / 7e-18 MAPKKK1, ANP1 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034217 194 / 4e-65 AT5G67080 60 / 2e-11 mitogen-activated protein kinase kinase kinase 19 (.1)
Lus10026894 157 / 2e-48 AT3G50310 187 / 1e-57 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10029019 149 / 7e-47 AT3G50310 96 / 3e-24 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034242 150 / 2e-45 AT3G50310 190 / 2e-58 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10029023 147 / 6e-45 AT3G50310 147 / 8e-43 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034288 142 / 4e-42 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10039141 140 / 4e-41 AT3G46140 168 / 1e-49 Protein kinase superfamily protein (.1)
Lus10034285 138 / 1e-40 AT5G27510 183 / 6e-56 Protein kinase superfamily protein (.1)
Lus10031963 125 / 8e-38 AT3G06030 87 / 1e-21 NPK1-related protein kinase 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131100 95 / 8e-24 AT3G50310 200 / 4e-62 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.007G044800 90 / 9e-22 AT5G67080 350 / 6e-120 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.005G139300 87 / 8e-21 AT5G67080 329 / 6e-112 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.006G181000 86 / 3e-20 AT3G45670 213 / 4e-66 Protein kinase superfamily protein (.1)
Potri.002G129100 83 / 6e-19 AT5G66850 441 / 5e-145 mitogen-activated protein kinase kinase kinase 5 (.1)
Potri.001G042400 82 / 7e-19 AT3G50310 236 / 5e-75 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.005G139200 81 / 1e-18 AT5G67080 305 / 2e-102 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.014G035500 82 / 2e-18 AT5G66850 453 / 4e-149 mitogen-activated protein kinase kinase kinase 5 (.1)
Potri.003G184200 80 / 3e-18 AT4G36950 246 / 8e-79 mitogen-activated protein kinase kinase kinase 21 (.1)
Potri.005G033400 81 / 4e-18 AT1G09000 680 / 0.0 MAP KINASE KINASE KINASE 1, NPK1-related protein kinase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10029047 pacid=23151811 polypeptide=Lus10029047 locus=Lus10029047.g ID=Lus10029047.BGIv1.0 annot-version=v1.0
ATGGAGAGCCGGGAGATACGTCCGACGGGAAGGGACTTCAGGGGAACGGTCAGATACCTTCCGCCGGAGATGATTTGGCTGGGGAAGGTGTCCCCGGCGA
TGGATATATGGGCTTTGGGATGCAGTGTGATCGAGATGCTGACCGGAAACTTGCCGTGGAATGATTTGAAGGAGGAAAAAGATGTGATGAGCGTGATCGG
AAAGGGAGGTCAGCCGGAGATTCCGGAGTGGGTTTCCGAAGAGGGAAAGGATTTTCTGCACAAGTGCTTTATTAGGTGTTCGCAGCAGCGTTTTCCGGCT
AAATTGCTTATGCAGCACCCGTTCGTCACTGGCGGGAGGATTTCGAAGGCGGTGATCGGACCAACAGGAAGGAATCGGAGTGTTGGCAGGGAAACAATGG
CGGCGCCAGAGCAGAGGTCCCCTCCTGCCGCTGCTGTTTACACTCTGTTTCCTACTCATCAAGCTGCTTTGGTCGCACTTTGA
AA sequence
>Lus10029047 pacid=23151811 polypeptide=Lus10029047 locus=Lus10029047.g ID=Lus10029047.BGIv1.0 annot-version=v1.0
MESREIRPTGRDFRGTVRYLPPEMIWLGKVSPAMDIWALGCSVIEMLTGNLPWNDLKEEKDVMSVIGKGGQPEIPEWVSEEGKDFLHKCFIRCSQQRFPA
KLLMQHPFVTGGRISKAVIGPTGRNRSVGRETMAAPEQRSPPAAAVYTLFPTHQAALVAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G50310 MKKK20, MAPKKK2... MAPKK kinase 20, mitogen-activ... Lus10029047 0 1
AT5G59720 HSP18.2 HSP18.1... heat shock protein 18.2 (.1) Lus10022314 3.2 0.7035
Lus10038619 9.8 0.7342
Lus10000169 12.0 0.7320
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10028514 12.1 0.7350
AT5G67360 ARA12 Subtilase family protein (.1) Lus10000433 14.1 0.6853
AT2G46910 Plastid-lipid associated prote... Lus10000058 16.1 0.6940
AT1G03495 HXXXD-type acyl-transferase fa... Lus10039721 20.1 0.6918
Lus10040805 43.8 0.6507
AT3G21690 MATE efflux family protein (.1... Lus10002067 47.6 0.6862
AT4G26590 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10022313 52.1 0.6437

Lus10029047 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.