Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40480 114 / 8e-31 Plant protein of unknown function (DUF827) (.1) AT3G56270 73 / 4e-16 Plant protein of unknown function (DUF827) (.1) AT2G38370 65 / 4e-13 Plant protein of unknown function (DUF827) (.1) AT4G33390 45 / 3e-06 Plant protein of unknown function (DUF827) (.1) AT3G51720 42 / 2e-05 Plant protein of unknown function (DUF827) (.1) AT2G26570 39 / 0.0003 WEB1 WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1, Plant protein of unknown function (DUF827) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034211 [exp] 177 / 6e-54 AT2G40480 385 / 1e-128 Plant protein of unknown function (DUF827) (.1) Lus10025249 [exp] 76 / 6e-17 AT2G38370 327 / 5e-105 Plant protein of unknown function (DUF827) (.1) Lus10009099 [exp] 76 / 7e-17 AT2G38370 340 / 1e-107 Plant protein of unknown function (DUF827) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G049201 [exp] 129 / 3e-36 AT2G40480 358 / 3e-117 Plant protein of unknown function (DUF827) (.1) Potri.016G133300 [exp] 88 / 3e-21 AT2G38370 258 / 2e-78 Plant protein of unknown function (DUF827) (.1) Potri.002G126700 [exp] 39 / 0.0005 AT2G26570 694 / 0.0 WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1, Plant protein of unknown function (DUF827) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05701 [flax] [poplar] WEMBL Weak chloroplast movement under blue light
Representative CDS sequence Show only first row Show all	>Lus10029056 pacid=23151793 polypeptide=Lus10029056 locus=Lus10029056.g ID=Lus10029056.BGIv1.0 annot-version=v1.0 ATGTCCGACGAATCTCCTCCGGCGCCGGATCCGGTGCCGGGAACTCCTGGAATCGACGAGATGAGATCCGAGCTTGGAGGGTTCTGCCCTGACCACGGAG GCGGCGACGGCGGAACAACAGGGACGACGAGGGAGTTAGGGCTGAGAGCCGAGGTCGACACCTCGCCGCCGTTTGGGTCGGTGAAGGAAGCCGTTGATCG GTTCGGCGGCAGCGGGCCGTGGGTTCCCTGTTACAGAATTGGAGACGACTTTGGGGAGATAGACATAAAGAAAGTGGAGAAACAAGCTGCTGAGCTAGAA AAAGATTTGATAGTGAAGGAATTGGAAACACTGGATGTTCTTGAAGAACTGGGACAACCAAGAAGATTGTGGAAGATTTGA
AA sequence Show only first row Show all	>Lus10029056 pacid=23151793 polypeptide=Lus10029056 locus=Lus10029056.g ID=Lus10029056.BGIv1.0 annot-version=v1.0 MSDESPPAPDPVPGTPGIDEMRSELGGFCPDHGGGDGGTTGTTRELGLRAEVDTSPPFGSVKEAVDRFGGSGPWVPCYRIGDDFGEIDIKKVEKQAAELE KDLIVKELETLDVLEELGQPRRLWKI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G40480			Plant protein of unknown funct...		Lus10029056 [exp]	0	1
AT1G33470			RNA-binding (RRM/RBD/RNP motif...		Lus10039151 [exp]	5.7	0.8070
AT1G33470			RNA-binding (RRM/RBD/RNP motif...		Lus10013781 [exp]	6.2	0.7784
AT2G40480			Plant protein of unknown funct...		Lus10029055 [exp]	6.3	0.7765
AT4G18020	GARP	APRR2	PSEUDO-RESPONSE REGULATOR 2, C...		Lus10040109 [exp]	8.8	0.7754
AT4G14350			AGC (cAMP-dependent, cGMP-depe...		Lus10011814 [exp]	10.6	0.7854
AT3G20650			mRNA capping enzyme family pro...		Lus10039035 [exp]	12.0	0.7518
AT5G15080			Protein kinase superfamily pro...		Lus10006643 [exp]	21.7	0.7706
AT4G13800			Protein of unknown function (D...		Lus10022549 [exp]	22.6	0.7257
AT3G19960		ATM1, ATATM	myosin 1 (.1.2)		Lus10010173 [exp]	30.3	0.7776
AT4G36630		EMB2754	EMBRYO DEFECTIVE 2754, Vacuola...		Lus10026018 [exp]	32.6	0.7733

Compare expression of checked genes

Lus10029056 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.