Lus10029062 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05340 253 / 3e-83 Peroxidase superfamily protein (.1)
AT5G58400 222 / 6e-71 Peroxidase superfamily protein (.1)
AT5G58390 206 / 6e-65 Peroxidase superfamily protein (.1)
AT5G06730 163 / 8e-48 Peroxidase superfamily protein (.1)
AT5G06720 161 / 2e-47 ATPA2 peroxidase 2 (.1)
AT4G36430 160 / 6e-47 Peroxidase superfamily protein (.1)
AT3G50990 156 / 3e-45 Peroxidase superfamily protein (.1)
AT2G18140 155 / 4e-45 Peroxidase superfamily protein (.1)
AT5G66390 155 / 5e-45 Peroxidase superfamily protein (.1)
AT3G32980 150 / 6e-43 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034207 369 / 2e-128 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10006534 237 / 1e-76 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10000346 228 / 2e-72 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Lus10030149 219 / 2e-69 AT5G05340 405 / 8e-142 Peroxidase superfamily protein (.1)
Lus10030148 213 / 5e-68 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10009932 216 / 5e-67 AT5G05340 419 / 6e-146 Peroxidase superfamily protein (.1)
Lus10032786 204 / 5e-64 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10003573 202 / 1e-63 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1)
Lus10024209 198 / 1e-61 AT1G14550 432 / 3e-153 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G083600 280 / 8e-94 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.013G156500 256 / 2e-84 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1)
Potri.013G156400 226 / 4e-72 AT5G05340 412 / 1e-144 Peroxidase superfamily protein (.1)
Potri.013G154400 220 / 3e-70 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.014G143200 217 / 4e-69 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236870 206 / 7e-65 AT1G14550 409 / 3e-144 Peroxidase superfamily protein (.1)
Potri.010G236910 205 / 2e-64 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236850 205 / 2e-64 AT1G14550 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.010G236900 204 / 3e-64 AT1G14550 407 / 2e-143 Peroxidase superfamily protein (.1)
Potri.016G132700 202 / 2e-63 AT5G05340 367 / 2e-127 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10029062 pacid=23151807 polypeptide=Lus10029062 locus=Lus10029062.g ID=Lus10029062.BGIv1.0 annot-version=v1.0
ATGGCTTCTACTTCTAGTGTTGTCATGAGCTTGGCTATGGCGATGCTGCTCCTAGTTGTTGGGAGCAGTGAAGCTCAGCTCTCCACGAACTTCTACTCGA
AATCCTGCCCTAAGCTTCACGAAGCTATCCTCCCTGTCGTTCAGGCTGCTGTTAGGAAAGAAGCTCGCATGGGCGCTTCTCTTCTTCGCCTCTTCTTCCA
TGACTGCTTTGTCAATGGATGCGACGGCTCCATTCTGCTGGACGACACCTCCTCCTTCACCGGAGAGAAGAACGCCAACCCGAACCGCAACTCCGCCAGG
GCACCACCCCAAACCGCAACTCCGCTAGAGGCTTTGACGTCATCGACAACATCAAGGCCGCCGTCGAGAAGGCTTGCCCCGGCGTCGTATCATGCGCCGA
CGTCCTCGCCATCTCCGCCCCTGGGGGGTCCCACCTGGAACGTGAAACTCGGGAGGCGAGACGCAAGGACAAATCCCGCCGCCGACGTCCAAGCAAAACC
GTCTCACCAGCCGGTTCAACGCGCTGGGCCGAGAATCTACAACGAGAACAACATCGACGGGTCGTTAGCCCGGACCCGGAGATCCAATTGCCCGAGCCGG
AACGGAACCGGAGACAACAACCTGGCGCCGCTCGATTTCCAGACCCCGACCTCGTTCGACAACCGCTACTTTGGAAACCTCGTCAGCCAGCGCGGGCTGC
TACACTCCGACCAGCAGCTGTTCTCCGGCGCCGGGTCTACCGACTCGATCGTTCGTAGCTACAGCACTAATGAGGGGGCGTTCAAGTCTGATTTCGCGTC
GGCGATGGTGAAGATGGGAGATATTAGCCCTTTGACTGGATCGAGCGGCGAGATCAGGAGGAACTGCAGGAGGCCGAATTAA
AA sequence
>Lus10029062 pacid=23151807 polypeptide=Lus10029062 locus=Lus10029062.g ID=Lus10029062.BGIv1.0 annot-version=v1.0
MASTSSVVMSLAMAMLLLVVGSSEAQLSTNFYSKSCPKLHEAILPVVQAAVRKEARMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNANPNRNSAR
APPQTATPLEALTSSTTSRPPSRRLAPASYHAPTSSPSPPLGGPTWNVKLGRRDARTNPAADVQAKPSHQPVQRAGPRIYNENNIDGSLARTRRSNCPSR
NGTGDNNLAPLDFQTPTSFDNRYFGNLVSQRGLLHSDQQLFSGAGSTDSIVRSYSTNEGAFKSDFASAMVKMGDISPLTGSSGEIRRNCRRPN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05340 Peroxidase superfamily protein... Lus10029062 0 1
AT4G27290 S-locus lectin protein kinase ... Lus10014811 1.0 0.9765
AT5G39150 RmlC-like cupins superfamily p... Lus10003116 1.4 0.9750
AT1G55850 ATCSLE1 cellulose synthase like E1 (.1... Lus10016625 1.7 0.9689
AT5G05340 Peroxidase superfamily protein... Lus10025255 2.0 0.9631
AT4G21440 MYB ATMYB102, ATM4 A. THALIANA MYB 4, MYB-like 10... Lus10033735 2.8 0.9515
AT4G27290 S-locus lectin protein kinase ... Lus10038553 3.7 0.9529
AT5G38200 Class I glutamine amidotransfe... Lus10028493 3.9 0.9598
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Lus10022329 5.2 0.9500
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10013830 6.9 0.9552
AT5G41350 RING/U-box superfamily protein... Lus10032270 7.4 0.9465

Lus10029062 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.