Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034200 [exp] 80 / 3e-19 AT3G19850 390 / 1e-129 Phototropic-responsive NPH3 family protein (.1) Lus10012901 [exp] 49 / 3e-08 AT3G19850 415 / 3e-138 Phototropic-responsive NPH3 family protein (.1) Lus10030554 [exp] 46 / 2e-07 AT3G19850 414 / 5e-138 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G085500 [exp] 35 / 0.0008 AT3G19850 449 / 2e-152 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029069 pacid=23151770 polypeptide=Lus10029069 locus=Lus10029069.g ID=Lus10029069.BGIv1.0 annot-version=v1.0 ATGTCAACTCCCAAGAGACCTTCTTCCTCAATCAGGAATATCATCCACCAACAAACCCAAATGATCAGGTTTTCACGAATCGAGATCCAAGGCTTCCCCG GTGACCCGGCGGCTTTCGAGCAAGTCGCCGGATTCTGCTACTGTGGCCGCATCGGAGTTAAATGTTGGGAATATGATAGTTCAACCACTTGA
AA sequence Show only first row Show all	>Lus10029069 pacid=23151770 polypeptide=Lus10029069 locus=Lus10029069.g ID=Lus10029069.BGIv1.0 annot-version=v1.0 MSTPKRPSSSIRNIIHQQTQMIRFSRIEIQGFPGDPAAFEQVAGFCYCGRIGVKCWEYDSSTT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029069 [exp]	0	1
AT5G28740			Tetratricopeptide repeat (TPR)...		Lus10003865 [exp]	10.1	0.6791
AT1G52790			2-oxoglutarate (2OG) and Fe(II...		Lus10005776 [exp]	18.0	0.6390
AT5G42905			Polynucleotidyl transferase, r...		Lus10006008 [exp]	27.9	0.6419
AT2G37980			O-fucosyltransferase family pr...		Lus10040236 [exp]	42.9	0.6350
AT4G34135		UGT73B2	UDP-glucosyltransferase 73B2 (...		Lus10010240 [exp]	44.2	0.6264
AT3G56380		ARR17	response regulator 17 (.1)		Lus10029027 [exp]	57.1	0.6252
AT5G17390			Adenine nucleotide alpha hydro...		Lus10007982 [exp]	57.4	0.6060
					Lus10000292 [exp]	80.3	0.5582
					Lus10009363 [exp]	93.0	0.5900
					Lus10022574 [exp]	124.2	0.6067

Compare expression of checked genes

Lus10029069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.