Lus10029070 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19850 174 / 4e-50 Phototropic-responsive NPH3 family protein (.1)
AT1G50280 160 / 6e-45 Phototropic-responsive NPH3 family protein (.1)
AT5G64330 101 / 9e-24 JK218, RPT3, NPH3 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
AT1G03010 100 / 1e-23 Phototropic-responsive NPH3 family protein (.1)
AT1G52770 98 / 7e-23 Phototropic-responsive NPH3 family protein (.1)
AT5G48800 96 / 6e-22 Phototropic-responsive NPH3 family protein (.1)
AT1G30440 96 / 1e-21 Phototropic-responsive NPH3 family protein (.1)
AT3G08660 93 / 8e-21 Phototropic-responsive NPH3 family protein (.1)
AT1G67900 93 / 9e-21 Phototropic-responsive NPH3 family protein (.1.2.3)
AT5G13600 92 / 1e-20 Phototropic-responsive NPH3 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034200 371 / 6e-126 AT3G19850 390 / 1e-129 Phototropic-responsive NPH3 family protein (.1)
Lus10030554 201 / 3e-59 AT3G19850 414 / 5e-138 Phototropic-responsive NPH3 family protein (.1)
Lus10012901 196 / 1e-57 AT3G19850 415 / 3e-138 Phototropic-responsive NPH3 family protein (.1)
Lus10039710 126 / 1e-32 AT3G22104 433 / 9e-148 Phototropic-responsive NPH3 family protein (.1)
Lus10018499 121 / 6e-31 AT3G22104 420 / 2e-142 Phototropic-responsive NPH3 family protein (.1)
Lus10014337 101 / 1e-23 AT5G10250 620 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Lus10026046 100 / 3e-23 AT5G10250 639 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Lus10005943 97 / 4e-22 AT1G03010 881 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10038531 96 / 1e-21 AT1G30440 915 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G170900 201 / 8e-60 AT3G19850 426 / 2e-143 Phototropic-responsive NPH3 family protein (.1)
Potri.008G085500 187 / 1e-54 AT3G19850 449 / 2e-152 Phototropic-responsive NPH3 family protein (.1)
Potri.017G041600 126 / 1e-32 AT3G22104 488 / 4e-169 Phototropic-responsive NPH3 family protein (.1)
Potri.007G118800 117 / 3e-29 AT3G22104 505 / 1e-175 Phototropic-responsive NPH3 family protein (.1)
Potri.011G032100 111 / 3e-27 AT3G22104 309 / 4e-99 Phototropic-responsive NPH3 family protein (.1)
Potri.002G242300 103 / 2e-24 AT5G48800 899 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.004G030600 103 / 2e-24 AT3G22104 313 / 1e-100 Phototropic-responsive NPH3 family protein (.1)
Potri.007G112600 103 / 2e-24 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.002G209700 100 / 2e-23 AT1G03010 847 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.001G175400 99 / 4e-23 AT1G52770 507 / 8e-179 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03000 NPH3 NPH3 family
Representative CDS sequence
>Lus10029070 pacid=23151716 polypeptide=Lus10029070 locus=Lus10029070.g ID=Lus10029070.BGIv1.0 annot-version=v1.0
ATGACGGAGGCCGTCTCCGCCGGAAACCTCCTCAAACAGACGGAGCATTTCCTCCGCGGGATTCCTAGCTGGTCTTTGTCGGATGTCGTTTCGAGCGTAG
AATCGTGCGACTCTTTCTTCTCCTACGACAAGTTGGTAGACCTCGTGGAGAGGCTGATTTCCGGGGTGGTAGCGAAAATTTCCACGTCATCGGTTGACTC
TTCATCATCGGAGTCTTCTTCTTCAACGTCAGCGGATGACATGTTGCTCGATCAAGCCAGCCTGGACGATCTGCTGGTCACCGGCAATGACAATGGCAAT
GGCGATGGTCGGAGCTGTGTTTACGATGTCTATTTGGTTATAAGATTGGAAAGGGAGTTTGTTAATCATCATGGTAGTGATCAAGTTAGTCAGGAGATGA
AGAGAGTTGTGAGGTTGATTGATGAGTACTTAAGGGAGATATCTCCTGATCATAACTTGAAGATGGCTAAGTTCATGGAGGTTGCTGAGAGCTTGCCAAT
GGCTGCTAGGGAGAGCTTTGATGGAGTTTACAAAGCCATTGACATCTACCTTGAGACACATCGCAATCTTAACATGGAGGAGAGATCAAGACTGTGTGGA
TGTCTCAACTTTGATAACGTATCAATGGAGTCATGTAAAGAGATGGTCAAGAACCCAAAGATCCCACCAAGCGTTTCAGTTCAAACCCTCATGTCTAAGA
GATCTGCGGTCCCCAATTCAACCGATCGTGATCCATCTTTAACTCTGAGTAGGGTGAAATTAGGGAACATTGATCACGTGAGTGGATACTCGTGTAGTCC
TTCAACAAAAGGGATGGCACATCAGTTACATAACGAATCAGATATGGATTCGGAGATGGAGATGAGCGTGGCGAGGATGCATAAGAGGGTTGTGGAGTTG
GAGAGAAGTTGTAGGAAATTGTAG
AA sequence
>Lus10029070 pacid=23151716 polypeptide=Lus10029070 locus=Lus10029070.g ID=Lus10029070.BGIv1.0 annot-version=v1.0
MTEAVSAGNLLKQTEHFLRGIPSWSLSDVVSSVESCDSFFSYDKLVDLVERLISGVVAKISTSSVDSSSSESSSSTSADDMLLDQASLDDLLVTGNDNGN
GDGRSCVYDVYLVIRLEREFVNHHGSDQVSQEMKRVVRLIDEYLREISPDHNLKMAKFMEVAESLPMAARESFDGVYKAIDIYLETHRNLNMEERSRLCG
CLNFDNVSMESCKEMVKNPKIPPSVSVQTLMSKRSAVPNSTDRDPSLTLSRVKLGNIDHVSGYSCSPSTKGMAHQLHNESDMDSEMEMSVARMHKRVVEL
ERSCRKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19850 Phototropic-responsive NPH3 fa... Lus10029070 0 1
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10018433 4.8 0.7497
AT1G51990 O-methyltransferase family pro... Lus10005268 5.7 0.7348
Lus10010827 9.2 0.7212
AT1G15550 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS TH... Lus10013135 10.6 0.7212
AT4G17260 Lactate/malate dehydrogenase f... Lus10006030 10.6 0.6845
AT5G17490 GRAS AtRGL3, RGL3 RGA-like protein 3 (.1) Lus10002424 11.8 0.7212
AT2G43620 Chitinase family protein (.1) Lus10020338 12.0 0.5652
Lus10022511 13.0 0.7212
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10024231 14.0 0.7212
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10017040 14.8 0.6687

Lus10029070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.