Lus10029078 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65440 147 / 1e-41 GTB1 global transcription factor group B1 (.1.2.3)
AT1G63210 105 / 3e-27 Transcription elongation factor Spt6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013071 226 / 2e-71 AT1G65440 275 / 7e-79 global transcription factor group B1 (.1.2.3)
Lus10011344 154 / 2e-44 AT1G65440 1946 / 0.0 global transcription factor group B1 (.1.2.3)
Lus10003130 154 / 3e-44 AT1G65440 1938 / 0.0 global transcription factor group B1 (.1.2.3)
Lus10034231 104 / 1e-26 AT1G65440 426 / 2e-133 global transcription factor group B1 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G029200 158 / 8e-46 AT1G65440 1961 / 0.0 global transcription factor group B1 (.1.2.3)
Potri.006G031900 155 / 2e-44 AT1G65440 1982 / 0.0 global transcription factor group B1 (.1.2.3)
Potri.001G034300 103 / 2e-26 AT1G65440 1251 / 0.0 global transcription factor group B1 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10029078 pacid=23151876 polypeptide=Lus10029078 locus=Lus10029078.g ID=Lus10029078.BGIv1.0 annot-version=v1.0
ATGGATGAGATCCTGAAGACTGAGAAAGCCGAGTCTCCAGGGAAGATAGTCTATTGCTTTGGCATTTCTCATGAGCATCCAGGCACTTTCATTCTAACCT
ACATAACGTCTACAAATCCACATCACGAATACGTAGGCCTCTCTCCGAAGGGATTCAAGTTCCGCAACCACGTGTTTGAGAACATCGATGAGCTTGTCAT
TTACTTCAAGAACCACATATATGATTGCCAGCAAAAATCAGGGCCGTCTATTAGATTGATGGCTTCCATGGTGCCGATGAGGAGCCACGCTTCTGGCAGA
GACCGCCCGTCCGGTCATGCGAGCGGCACGCCAAGGCCAAGGCTACACGATAGTGGACGAGGAAGAAATAAGTATAACAACGGTCGACAAGATTCTAGTT
GTGATCGTCCAAGATAG
AA sequence
>Lus10029078 pacid=23151876 polypeptide=Lus10029078 locus=Lus10029078.g ID=Lus10029078.BGIv1.0 annot-version=v1.0
MDEILKTEKAESPGKIVYCFGISHEHPGTFILTYITSTNPHHEYVGLSPKGFKFRNHVFENIDELVIYFKNHIYDCQQKSGPSIRLMASMVPMRSHASGR
DRPSGHASGTPRPRLHDSGRGRNKYNNGRQDSSCDRPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65440 GTB1 global transcription factor gr... Lus10029078 0 1
AT1G65440 GTB1 global transcription factor gr... Lus10029079 3.5 0.7640
AT5G39380 Plant calmodulin-binding prote... Lus10030701 13.6 0.7085
AT1G08800 Protein of unknown function, D... Lus10018782 13.7 0.7496
AT3G44716 unknown protein Lus10009406 23.9 0.6777
AT2G01818 PLATZ transcription factor fam... Lus10030763 32.1 0.7033
AT3G22420 ZIK3, WNK2, ATW... ARABIDOPSIS THALIANA WITH NO K... Lus10004904 32.2 0.6921
AT1G20225 Thioredoxin superfamily protei... Lus10021843 33.0 0.6386
AT1G64620 DOF AtDof1,8 Dof-type zinc finger DNA-bindi... Lus10033218 36.3 0.6841
AT2G26520 unknown protein Lus10020993 36.8 0.6739
AT1G08800 Protein of unknown function, D... Lus10024869 48.9 0.6534

Lus10029078 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.