Lus10029084 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10029084 pacid=23151648 polypeptide=Lus10029084 locus=Lus10029084.g ID=Lus10029084.BGIv1.0 annot-version=v1.0
ATGGGGAATAGTAGATCGAGGAGTGAGTGGCGGCATTCTAAACTCCTCTTCACCAGCTCTCGTCGGCTGTCTCCACATCTCAAATCCATCACCATCAACT
CAGAAATCTACCTCCATAGAGGAAGGCAGGAAGCCCGTTTCATTAGCCGCAATCTGCCGCCACCCATCCCTCTTGCTCGTCGTCTCCGGCTACACTCCGC
GCTAACCGCAGGCCAGCACTTGTTCATCGGTGCAAGCCCTCCAGCGGCGCTCAATCTTCAATCTCTCCTGGCTTCTTCCATCGTTTCAGCCCTTCTGCTA
AGGAGTTTGAGAGTCTCCTTCTTCAGTCCGGCGGCGGCTCATTGTCTGGGCTTCCTTCCACCAATTTGTACGGTGGCGGAAATGAGGAGGCGGCAGAGGA
GATCTCGAGATGGTAGTAGAAGCAGAGGGAAGATGTGA
AA sequence
>Lus10029084 pacid=23151648 polypeptide=Lus10029084 locus=Lus10029084.g ID=Lus10029084.BGIv1.0 annot-version=v1.0
MGNSRSRSEWRHSKLLFTSSRRLSPHLKSITINSEIYLHRGRQEARFISRNLPPPIPLARRLRLHSALTAGQHLFIGASPPAALNLQSLLASSIVSALLL
RSLRVSFFSPAAAHCLGFLPPICTVAEMRRRQRRSRDGSRSRGKM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029084 0 1
AT5G14720 Protein kinase superfamily pro... Lus10032144 7.1 0.8203
AT1G67390 F-box family protein (.1) Lus10029083 7.2 0.7680
AT1G18670 IBS1 IMPAIRED IN BABA-INDUCED STERI... Lus10015727 15.3 0.8095
AT5G54200 Transducin/WD40 repeat-like su... Lus10027671 15.4 0.8099
AT1G05960 ARM repeat superfamily protein... Lus10001161 17.7 0.7900
AT3G23340 CKL10 casein kinase I-like 10 (.1) Lus10000553 18.5 0.7771
AT3G13060 ECT5 evolutionarily conserved C-ter... Lus10033335 24.2 0.7872
AT2G26100 Galactosyltransferase family p... Lus10014451 24.3 0.8025
AT3G51950 C3HZnF Zinc finger (CCCH-type) family... Lus10039575 25.5 0.7855
AT2G38580 Mitochondrial ATP synthase D c... Lus10021384 26.1 0.7762

Lus10029084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.