Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003038 [exp] 67 / 6e-15 ND 61 / 7e-10 Lus10003770 [exp] 64 / 9e-15 ND / Lus10022177 [exp] 64 / 9e-15 ND 39 / 5e-04 Lus10025297 [exp] 60 / 3e-13 ND 52 / 2e-08 Lus10022953 [exp] 58 / 1e-12 ND / Lus10034854 [exp] 58 / 2e-12 AT1G48120 69 / 3e-14 hydrolases;protein serine/threonine phosphatases (.1) Lus10003842 [exp] 58 / 5e-12 AT1G48120 50 / 4e-07 hydrolases;protein serine/threonine phosphatases (.1) Lus10017017 [exp] 57 / 5e-12 AT1G48120 40 / 9e-05 hydrolases;protein serine/threonine phosphatases (.1) Lus10009239 [exp] 58 / 6e-12 ND 44 / 3e-05
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029087 pacid=23151871 polypeptide=Lus10029087 locus=Lus10029087.g ID=Lus10029087.BGIv1.0 annot-version=v1.0 ATGGTGGAGGGCGAGGTTATGTTCTTGCTCGGACTTACGCAAAGGAACGAGCACGCGTGGGAAGCGAGGGTTGATCTGTACATATGCCAGTGGACTTCCA GACGAAGGACAGTACAACAGTTCATCATTTACAAAGCCTACGACTCGTACGCCGTTGATCCACTAAGTCAGGCGACTGTCCCCCCGACCAGCTCGGATTG A
AA sequence Show only first row Show all	>Lus10029087 pacid=23151871 polypeptide=Lus10029087 locus=Lus10029087.g ID=Lus10029087.BGIv1.0 annot-version=v1.0 MVEGEVMFLLGLTQRNEHAWEARVDLYICQWTSRRRTVQQFIIYKAYDSYAVDPLSQATVPPTSSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029087 [exp]	0	1
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016495 [exp]	1.0	0.9613
					Lus10024490 [exp]	2.0	0.9476
					Lus10024103 [exp]	3.6	0.8642
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10022760 [exp]	3.9	0.9221
					Lus10014008 [exp]	4.9	0.8857
AT5G40960			Protein of unknown function (D...		Lus10032031 [exp]	4.9	0.8651
AT4G32900			Peptidyl-tRNA hydrolase II (PT...		Lus10011608 [exp]	5.0	0.9136
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Lus10027584 [exp]	5.3	0.8969
AT3G47600	MYB	ATMYB94, AtMYBC...	myb domain protein 94 (.1)		Lus10024218 [exp]	5.3	0.8628
					Lus10007244 [exp]	6.0	0.8567

Compare expression of checked genes

Lus10029087 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.