Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08710 115 / 2e-33 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT3G56420 103 / 7e-29 Thioredoxin superfamily protein (.1) AT3G51030 97 / 2e-26 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT2G40790 96 / 6e-26 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT1G45145 79 / 1e-19 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G39950 78 / 6e-19 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G19730 76 / 3e-18 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT3G17880 76 / 8e-17 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT5G42980 71 / 1e-16 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G11530 68 / 3e-15 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029009 [exp] 219 / 2e-74 AT3G08710 126 / 5e-38 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10012859 [exp] 183 / 4e-60 AT3G08710 134 / 9e-41 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10030505 [exp] 181 / 9e-59 AT3G08710 132 / 8e-40 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 128 / 1e-38 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10022727 [exp] 128 / 2e-38 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10041799 [exp] 97 / 2e-26 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 96 / 6e-26 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 92 / 2e-24 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 84 / 3e-21 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G138800 [exp] 134 / 5e-41 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.006G110100 [exp] 132 / 4e-40 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.019G062000 [exp] 121 / 7e-36 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.005G232700 [exp] 94 / 1e-25 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.007G018000 [exp] 94 / 3e-25 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 89 / 2e-23 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 82 / 3e-19 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.015G036000 [exp] 82 / 7e-19 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.008G194100 [exp] 73 / 6e-17 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.017G076700 [exp] 70 / 9e-16 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10029090 pacid=23151735 polypeptide=Lus10029090 locus=Lus10029090.g ID=Lus10029090.BGIv1.0 annot-version=v1.0 ATGAACATTGTTATTTGTTTTGCCGATGTTCGGCCGTTGTTACTCCAATCTACGGTGTTGCAAGGGAGCGATGGGGACCACGACCACGACCAAACGAAAC ACCACTTAGACCTCACGACGGGGAGAGTCCAGCTCATCGACACGATCCCTAAATGGGAAGCCAGCCTCCAAGAAGCGAAGGAGCCCGGAAAGATCGTGAT CGTCAACTTCAGCTCCTCGCGGAGCGGTCCTTGCTGGAGTATAGCTCGACAATACTACAAGCTGGCCGGCAAGTACCCTTCGATTACATTTGTTACGGTT GATGTGGATGCCCTCGCCGAGATGAGCTCGACGTGGGAAGTGAAGGCTACGCCGACGTTCTTTTTCTTGAGAGAAGGGAAGTTGGTAGATAAACACGTTG GTGCCGATAAGATTGAGCTTAAGACCAAGATTGCTGACATCGATAGTCTACCGTTACAATAG
AA sequence Show only first row Show all	>Lus10029090 pacid=23151735 polypeptide=Lus10029090 locus=Lus10029090.g ID=Lus10029090.BGIv1.0 annot-version=v1.0 MNIVICFADVRPLLLQSTVLQGSDGDHDHDQTKHHLDLTTGRVQLIDTIPKWEASLQEAKEPGKIVIVNFSSSRSGPCWSIARQYYKLAGKYPSITFVTV DVDALAEMSSTWEVKATPTFFFLREGKLVDKHVGADKIELKTKIADIDSLPLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10029090 [exp]	0	1
AT4G21870			HSP20-like chaperones superfam...		Lus10018346 [exp]	6.0	0.6737
AT3G18715		IDL4	inflorescence deficient in abs...		Lus10033523 [exp]	11.5	0.6536
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10020851 [exp]	16.4	0.6148
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10004251 [exp]	24.7	0.5989
AT3G59310			Eukaryotic protein of unknown ...		Lus10004060 [exp]	26.9	0.6445
AT3G23450			unknown protein		Lus10023749 [exp]	28.9	0.6242
AT4G26690		GDPDL3, GPDL2, ...	SHAVEN 3, MUTANT ROOT HAIR 5, ...		Lus10031604 [exp]	39.2	0.5821
AT1G61390			S-locus lectin protein kinase ...		Lus10031605 [exp]	44.4	0.5746
AT1G69550			disease resistance protein (TI...		Lus10024150 [exp]	45.0	0.5387
AT1G67680			SRP72 RNA-binding domain (.1)		Lus10036924 [exp]	45.6	0.5632

Compare expression of checked genes

Lus10029090 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.