Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64930 121 / 2e-33 CYP89A7 "cytochrome P450, family 87, subfamily A, polypeptide 7", cytochrome P450, family 87, subfamily A, polypeptide 7 (.1) AT2G12190 119 / 2e-32 CYP89A4 Cytochrome P450 superfamily protein (.1) AT5G61320 118 / 3e-32 CYP89A3 "cytochrome P450, family 89, subfamily A, polypeptide 3", cytochrome P450, family 89, subfamily A, polypeptide 3 (.1) AT1G64900 117 / 4e-32 CYP89A2 "cytochrome P450, family 89, subfamily A, polypeptide 2", cytochrome P450, family 89, subfamily A, polypeptide 2 (.1) AT1G64950 115 / 2e-31 CYP89A5 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) AT1G64940 115 / 3e-31 CYP89A6 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) AT3G03470 112 / 3e-30 CYP89A9 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1) AT5G04630 97 / 2e-24 CYP77A9 "cytochrome P450, family 77, subfamily A, polypeptide 9", cytochrome P450, family 77, subfamily A, polypeptide 9 (.1) AT1G11600 94 / 3e-23 CYP77B1 "cytochrome P450, family 77, subfamily B, polypeptide 1", cytochrome P450, family 77, subfamily B, polypeptide 1 (.1) AT3G10570 93 / 6e-23 CYP77A6 "cytochrome P450, family 77, subfamily A, polypeptide 6", cytochrome P450, family 77, subfamily A, polypeptide 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013067 [exp] 152 / 6e-45 AT1G64940 472 / 4e-163 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10028654 [exp] 107 / 3e-28 AT1G64940 562 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020359 [exp] 104 / 3e-27 AT1G64940 550 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020353 [exp] 103 / 1e-26 AT1G64940 572 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020360 [exp] 103 / 1e-26 AT1G64940 613 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10010229 [exp] 102 / 3e-26 AT1G64940 574 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10002138 [exp] 101 / 5e-26 AT1G64940 586 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10034156 [exp] 100 / 2e-25 AT5G04660 679 / 0.0 "cytochrome P450, family 77, subfamily A, polypeptide 4", cytochrome P450, family 77, subfamily A, polypeptide 4 (.1) Lus10007660 [exp] 93 / 7e-23 AT1G11600 706 / 0.0 "cytochrome P450, family 77, subfamily B, polypeptide 1", cytochrome P450, family 77, subfamily B, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G104600 [exp] 123 / 4e-34 AT1G64940 455 / 2e-156 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.007G088086 [exp] 112 / 4e-30 AT1G64950 636 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088018 [exp] 112 / 5e-30 AT1G64940 605 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.007G087950 [exp] 112 / 6e-30 AT1G64950 642 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088154 [exp] 112 / 7e-30 AT1G64950 639 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.005G079600 [exp] 107 / 4e-28 AT1G64940 575 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076501 [exp] 100 / 5e-28 AT1G64940 186 / 1e-57 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076600 [exp] 102 / 2e-26 AT1G64940 578 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076700 [exp] 102 / 2e-26 AT1G64940 592 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.008G025500 [exp] 100 / 1e-25 AT5G04660 761 / 0.0 "cytochrome P450, family 77, subfamily A, polypeptide 4", cytochrome P450, family 77, subfamily A, polypeptide 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10029092 pacid=23151803 polypeptide=Lus10029092 locus=Lus10029092.g ID=Lus10029092.BGIv1.0 annot-version=v1.0 ATGACCCCCTTAGACATCCGGATGTTGAACACAATGGCAATAGCCGTCGACGCATTCCGGCACTTGGCCTGGGAATATGCAACCGATCATCTTTTTACAG TCATCCTTTGGACGGTGACGGAGGACACGAAGCTGGGAGGGTACGACATTCCGAGGGACGCGATCATCAACGTGACGGTGGCGGATATGGGCCGGGACCC GGCGGTGTGGGAGGATCCGATGGAGTTTAGGCCGGAGAGGTTTTTGGCGGGAGGGGAGGAGCTCGATTTCAAGGGAGTGAAGGGGATTAAGATGATGCCG TTTGGGGCTGGTCGGAGGGTTTGTCCGGCGATATCTGTGGCGGTTCTGCATCTTGAGTGTTCGTGGCGAATTTGGTGA
AA sequence Show only first row Show all	>Lus10029092 pacid=23151803 polypeptide=Lus10029092 locus=Lus10029092.g ID=Lus10029092.BGIv1.0 annot-version=v1.0 MTPLDIRMLNTMAIAVDAFRHLAWEYATDHLFTVILWTVTEDTKLGGYDIPRDAIINVTVADMGRDPAVWEDPMEFRPERFLAGGEELDFKGVKGIKMMP FGAGRRVCPAISVAVLHLECSWRIW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64930		CYP89A7	"cytochrome P450, family 87, s...		Lus10029092 [exp]	0	1

Compare expression of checked genes

Lus10029092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.