Lus10029097 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013062 240 / 1e-82 ND 37 / 0.003
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G134800 51 / 9e-09 ND /
Potri.008G113800 48 / 1e-07 ND /
PFAM info
Representative CDS sequence
>Lus10029097 pacid=23151661 polypeptide=Lus10029097 locus=Lus10029097.g ID=Lus10029097.BGIv1.0 annot-version=v1.0
ATGAATTCTTCTTCCCATGTTCTTGGAAGTTCAAAGAATTTGAGTGGGACTAAAGCCATTGAGTCTGGCTGGACAGACTATCTTGGCTCCTGGTGCTATG
AAGATGAAGATTGCATGCATAAAAAACAAGTGAATCACAAGAATACTGGCTATGGCTATAGAAGTGATGAAGAAGATGATGATGAAGGAGAGAGCGATGA
CTCCATGGTCTCAGATGCCTCATCTGGCCCAAGTCATTCTGAACTTCCAAGCACCCAAAAGAAGGCTGTGTTTTGCTCATCAAGGAAAGACCATAAATTT
GGGAAGCAAAGAGATGAAGCAAGGATCAAGGTGGATAAAGAAGAGTACATGGTATATGCAAAAAGTGCAGCTAGCGACAATGGATTGAAGGTTCGGAAAA
CCAAGAAGATGGAGCTTAAAACAGAGAAGGTCTAA
AA sequence
>Lus10029097 pacid=23151661 polypeptide=Lus10029097 locus=Lus10029097.g ID=Lus10029097.BGIv1.0 annot-version=v1.0
MNSSSHVLGSSKNLSGTKAIESGWTDYLGSWCYEDEDCMHKKQVNHKNTGYGYRSDEEDDDEGESDDSMVSDASSGPSHSELPSTQKKAVFCSSRKDHKF
GKQRDEARIKVDKEEYMVYAKSAASDNGLKVRKTKKMELKTEKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029097 0 1
Lus10013062 1.0 0.9464
AT5G25330 Core-2/I-branching beta-1,6-N-... Lus10002919 8.0 0.8359
AT1G70060 SNL4 SIN3-like 4 (.1) Lus10030814 8.9 0.7897
AT1G73190 ALPHA-TIP, TIP3... ALPHA-TONOPLAST INTRINSIC PROT... Lus10042375 9.0 0.8037
AT4G33940 RING/U-box superfamily protein... Lus10014366 10.4 0.8117
AT5G66320 GATA GATA5 GATA transcription factor 5 (.... Lus10041810 13.4 0.7730
AT3G52150 RNA-binding (RRM/RBD/RNP motif... Lus10041602 18.1 0.8432
AT1G20810 FKBP-like peptidyl-prolyl cis-... Lus10025158 21.7 0.7994
AT4G30845 unknown protein Lus10026098 22.8 0.8385
AT1G53800 unknown protein Lus10037460 24.9 0.7786

Lus10029097 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.