Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029106 [exp] 90 / 9e-25 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G466250 [exp] 42 / 2e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029107 pacid=23151763 polypeptide=Lus10029107 locus=Lus10029107.g ID=Lus10029107.BGIv1.0 annot-version=v1.0 ATGAAGAACTCTTCAGCAGCCACCAAGATTGTTTTCTCACTTCTTCTCCTATCCATAGTTTCCTGTATGGTGATGAGAGTCGCGGAAGCGAGGGGACCGA TTGTTAATTTTCGCTGCGAAACGGTCTTTGATTGCCAAGATAAAGGGTGGTGTAAAGGCTGCGCCGTTTGTCAATGTTCATCCCATTTATGCAATTGCAT TAATGCGGAATCGGATGTCGCTAATGCTCTGATACACCCACCGGCAACTTCCAACAACAATGCTTAG
AA sequence Show only first row Show all	>Lus10029107 pacid=23151763 polypeptide=Lus10029107 locus=Lus10029107.g ID=Lus10029107.BGIv1.0 annot-version=v1.0 MKNSSAATKIVFSLLLLSIVSCMVMRVAEARGPIVNFRCETVFDCQDKGWCKGCAVCQCSSHLCNCINAESDVANALIHPPATSNNNA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10029107 [exp]	0	1
					Lus10003536 [exp]	4.2	1.0000
					Lus10011425 [exp]	5.8	1.0000
AT2G39510			nodulin MtN21 /EamA-like trans...		Lus10023431 [exp]	6.7	1.0000
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10031524 [exp]	7.3	1.0000
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10025669 [exp]	8.9	1.0000
AT1G75660		AtXRN3, XRN3	5'-3' exoribonuclease 3 (.1)		Lus10013328 [exp]	10.5	1.0000
AT1G14000		VIK	VH1-interacting kinase (.1)		Lus10004066 [exp]	11.4	1.0000
AT4G27790			Calcium-binding EF hand family...		Lus10005911 [exp]	11.8	1.0000
					Lus10032359 [exp]	12.0	1.0000
					Lus10028667 [exp]	12.5	1.0000

Compare expression of checked genes

Lus10029107 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.