Lus10029108 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22720 352 / 4e-123 Actin-like ATPase superfamily protein (.1.2)
AT2G45270 79 / 4e-17 GCP1 glycoprotease 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013054 385 / 1e-138 AT4G22720 352 / 6e-123 Actin-like ATPase superfamily protein (.1.2)
Lus10000791 72 / 7e-15 AT2G45270 664 / 0.0 glycoprotease 1 (.1)
Lus10030285 67 / 6e-13 AT2G45270 550 / 0.0 glycoprotease 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G029200 353 / 1e-123 AT4G22720 652 / 0.0 Actin-like ATPase superfamily protein (.1.2)
Potri.007G129400 230 / 3e-78 AT4G22720 240 / 4e-80 Actin-like ATPase superfamily protein (.1.2)
Potri.014G067800 71 / 2e-14 AT2G45270 655 / 0.0 glycoprotease 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0108 Actin_ATPase PF00814 TsaD tRNA N6-adenosine threonylcarbamoyltransferase
Representative CDS sequence
>Lus10029108 pacid=23151775 polypeptide=Lus10029108 locus=Lus10029108.g ID=Lus10029108.BGIv1.0 annot-version=v1.0
ATGAAGAAACTGATCGCTATAGGGTTCGAAGGCTCGGCGAACAAGATCGGAGTCGGAGTCGTCGCGCTAGACGGAACAATCCTCTCCAACCCACGGCACA
CTTATATCACTCCCCCAGGCCATGGCTTCCTCCCTCGAGAAACCGCTCACCACCATCTCCGCCACGTGCTGCCCCTCGTCCAGTCAGCGCTCGACGCCGC
TGGACTGAATCCCGACGATGTCGATTGCATCTGCTACACTAAAGGCCCCGGGATGGGCGCGCCGCTGCAGGTCTCCGCCATCGTCGTTCGTGTCCTTTCC
CTGCTCTGGAAGAAACCGATTGTCGCCGTCAACCACTGCGTCGCTCATATCGAAATGGGCCGGGTCGTCACCGGTGCACATGACCCGGTTGTGCTCTACG
TTAGCGGCGGGAACACTCAGGTGATTGCTTATAGTGAAGGCAAGTATCGGATTTTCGGGGAGACTATTGATATCGCTGTGGGGAATTGTTTGGATCGGTT
CGCTAGGGTCTTGCAGCTTTCCAATGATCCTGCTCCTGGCTACAACATTGAGCAGGTGATTGATTATGGGGTATTTGGATTGAATTGA
AA sequence
>Lus10029108 pacid=23151775 polypeptide=Lus10029108 locus=Lus10029108.g ID=Lus10029108.BGIv1.0 annot-version=v1.0
MKKLIAIGFEGSANKIGVGVVALDGTILSNPRHTYITPPGHGFLPRETAHHHLRHVLPLVQSALDAAGLNPDDVDCICYTKGPGMGAPLQVSAIVVRVLS
LLWKKPIVAVNHCVAHIEMGRVVTGAHDPVVLYVSGGNTQVIAYSEGKYRIFGETIDIAVGNCLDRFARVLQLSNDPAPGYNIEQVIDYGVFGLN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22720 Actin-like ATPase superfamily ... Lus10029108 0 1
AT2G45590 Protein kinase superfamily pro... Lus10036533 3.5 0.7933
AT5G47660 Trihelix Homeodomain-like superfamily p... Lus10038779 3.9 0.7930
AT3G12915 Ribosomal protein S5/Elongatio... Lus10031779 9.4 0.7980
AT5G07900 Mitochondrial transcription te... Lus10004957 12.3 0.7875
AT2G35790 unknown protein Lus10023498 17.9 0.7622
AT5G51280 DEAD-box protein abstrakt, put... Lus10023252 19.1 0.7720
AT3G18310 unknown protein Lus10025089 19.4 0.7566
AT4G01100 ADNT1 adenine nucleotide transporter... Lus10032364 22.4 0.6893
AT1G53900 Eukaryotic translation initiat... Lus10037452 22.8 0.7260
AT4G35870 early-responsive to dehydratio... Lus10028409 25.3 0.7636

Lus10029108 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.