Lus10029112 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68940 197 / 5e-58 Armadillo/beta-catenin-like repeat family protein (.1.2.3)
AT1G20780 124 / 3e-32 ATPUB44, SAUL1 ARABIDOPSIS THALIANA PLANT U-BOX 44, senescence-associated E3 ubiquitin ligase 1 (.1)
AT1G76390 117 / 7e-30 PUB43 plant U-box 43, ARM repeat superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013050 360 / 4e-118 AT1G68940 900 / 0.0 Armadillo/beta-catenin-like repeat family protein (.1.2.3)
Lus10013216 117 / 6e-30 AT1G76390 1034 / 0.0 plant U-box 43, ARM repeat superfamily protein (.1.2)
Lus10030734 117 / 8e-30 AT1G76390 854 / 0.0 plant U-box 43, ARM repeat superfamily protein (.1.2)
Lus10030224 58 / 2e-09 AT1G20780 127 / 1e-29 ARABIDOPSIS THALIANA PLANT U-BOX 44, senescence-associated E3 ubiquitin ligase 1 (.1)
Lus10005988 57 / 2e-09 AT1G76390 244 / 4e-68 plant U-box 43, ARM repeat superfamily protein (.1.2)
Lus10043453 53 / 7e-08 AT1G76390 158 / 1e-39 plant U-box 43, ARM repeat superfamily protein (.1.2)
Lus10039402 51 / 2e-07 AT1G76390 157 / 4e-39 plant U-box 43, ARM repeat superfamily protein (.1.2)
Lus10018246 51 / 3e-07 AT1G76390 272 / 8e-78 plant U-box 43, ARM repeat superfamily protein (.1.2)
Lus10040659 51 / 4e-07 AT1G76390 286 / 1e-82 plant U-box 43, ARM repeat superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G112900 236 / 6e-72 AT1G68940 927 / 0.0 Armadillo/beta-catenin-like repeat family protein (.1.2.3)
Potri.010G136500 229 / 2e-69 AT1G68940 913 / 0.0 Armadillo/beta-catenin-like repeat family protein (.1.2.3)
Potri.005G253400 136 / 1e-36 AT1G76390 963 / 0.0 plant U-box 43, ARM repeat superfamily protein (.1.2)
Potri.002G007800 134 / 5e-36 AT1G76390 1028 / 0.0 plant U-box 43, ARM repeat superfamily protein (.1.2)
Potri.003G201000 62 / 5e-11 AT1G68940 119 / 2e-27 Armadillo/beta-catenin-like repeat family protein (.1.2.3)
Potri.012G019900 60 / 4e-10 AT1G76390 206 / 3e-55 plant U-box 43, ARM repeat superfamily protein (.1.2)
Potri.001G069501 58 / 1e-09 AT1G68940 132 / 5e-31 Armadillo/beta-catenin-like repeat family protein (.1.2.3)
Potri.014G102000 56 / 5e-09 AT1G76390 207 / 1e-55 plant U-box 43, ARM repeat superfamily protein (.1.2)
Potri.002G175800 52 / 2e-07 AT1G76390 201 / 2e-53 plant U-box 43, ARM repeat superfamily protein (.1.2)
Potri.010G079200 48 / 2e-06 AT1G20780 158 / 1e-39 ARABIDOPSIS THALIANA PLANT U-BOX 44, senescence-associated E3 ubiquitin ligase 1 (.1)
PFAM info
Representative CDS sequence
>Lus10029112 pacid=23151838 polypeptide=Lus10029112 locus=Lus10029112.g ID=Lus10029112.BGIv1.0 annot-version=v1.0
ATGCTCTATCTCGCCAGAACCTATGACTTCACGTCTGTGTTTAGCGAATTCCTGACGAAAACATCGAGTGACGAAGTCCAGAGGCTGTCAGCATTCGGGC
TGGAGAATCTGTCAGCAGAATCTGTAAACCTGTCAAAACCACCACCAAAGGCCAAAAAACCGAATTCGATCGCAAAAAGCTCCAGCTTTCGAAAGTTCTT
ATCTTTCGGGCCATCAAAGAAGAATACAAGGACAAGGACCGCGACCATCTGTCAGGTTCACCGAGGAGTATGCTCCTCGCGGGACACATTCTGCTTAGTT
GAAGCAAAAGCGGTGGAGAGGCTGCTAATGTGCTTGGATCACGAGAATATTAAGGTCGTTGATGCTGCGTTATCAGCCATATCGACTCTGTTGGATGAAA
GAGTCAATCTCAATAGCAGCGATGCATTATTGACCGAAATGAGTGCTGTAAGGCAAATCCTGCAGGTGCTGAAAGATCAGAGAAGTGAAGTTCTATGGCA
CAAGTGCTTCTGGGTTCTAGAGAGGTTCCTGACGAGTAATGGCGGTTACTGTTCCGTTCAAGATATATCGAATGACAGGTCGTTGCCTGCGATTTTGATC
AGTGCTTACCATCACGGGGATGGTGATACTCGTCAGATGGCCGAGAACCTGAACCGGGGCCTAGCTACAGAACTACCCATTTTACCATGTAGATAA
AA sequence
>Lus10029112 pacid=23151838 polypeptide=Lus10029112 locus=Lus10029112.g ID=Lus10029112.BGIv1.0 annot-version=v1.0
MLYLARTYDFTSVFSEFLTKTSSDEVQRLSAFGLENLSAESVNLSKPPPKAKKPNSIAKSSSFRKFLSFGPSKKNTRTRTATICQVHRGVCSSRDTFCLV
EAKAVERLLMCLDHENIKVVDAALSAISTLLDERVNLNSSDALLTEMSAVRQILQVLKDQRSEVLWHKCFWVLERFLTSNGGYCSVQDISNDRSLPAILI
SAYHHGDGDTRQMAENLNRGLATELPILPCR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68940 Armadillo/beta-catenin-like re... Lus10029112 0 1
AT1G68940 Armadillo/beta-catenin-like re... Lus10029113 1.0 0.9624
AT4G19510 Disease resistance protein (TI... Lus10002250 2.4 0.9401
Lus10040954 3.2 0.9405
AT2G32080 PUR ALPHA-1, PU... purin-rich alpha 1 (.1.2) Lus10020245 5.5 0.9441
AT5G48060 C2 calcium/lipid-binding plant... Lus10015709 5.5 0.9501
AT1G14740 Protein of unknown function (D... Lus10030769 6.9 0.9340
Lus10023403 7.1 0.9195
AT3G16230 Predicted eukaryotic LigT (.1.... Lus10006828 8.8 0.9323
AT5G06130 chaperone protein dnaJ-related... Lus10021316 9.0 0.9386
AT4G23050 PAS domain-containing protein ... Lus10017844 10.8 0.9269

Lus10029112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.