Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48750 77 / 8e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G18280 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38170 61 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73780 60 / 4e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38195 58 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G66850 58 / 3e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38160 56 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G14846 56 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G43666 56 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38197 50 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013030 [exp] 100 / 3e-29 AT3G18280 109 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017615 [exp] 62 / 9e-14 AT5G38195 91 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033574 [exp] 61 / 2e-13 AT3G18280 97 / 8e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017616 [exp] 60 / 7e-13 AT3G18280 100 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033573 [exp] 57 / 6e-12 AT5G38195 92 / 9e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G044500 [exp] 86 / 1e-23 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 85 / 4e-23 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.017G118700 [exp] 76 / 1e-19 AT3G18280 87 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G096000 [exp] 70 / 3e-17 AT3G18280 82 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10029131 pacid=23151845 polypeptide=Lus10029131 locus=Lus10029131.g ID=Lus10029131.BGIv1.0 annot-version=v1.0 ATGAGGAGATCGTTGGTATTGTTGAGTTTGGCAGTGGTGGCACTACTGTTGGCAGTGGCAGCTGGCGGGGCGAAGGCGGCGGTGACGTGTAGCCCGGTGC AGCTGAGCTCGTGCGCGTCTGCGATAAGCTCGTCGACGCCGCCCTCGAGGCAGTGCTGCAACAAGATCAGAGAGCAGAAGCCGTGCCTCTGCGGGTACCT GAAGAATCCAGCACTCAGGGCGTACATCAACACTCCAAATGCCAGGAAAGTCGCCTCCAGTTGCGGGACCCCCTTCCCCAACTGCTAA
AA sequence Show only first row Show all	>Lus10029131 pacid=23151845 polypeptide=Lus10029131 locus=Lus10029131.g ID=Lus10029131.BGIv1.0 annot-version=v1.0 MRRSLVLLSLAVVALLLAVAAGGAKAAVTCSPVQLSSCASAISSSTPPSRQCCNKIREQKPCLCGYLKNPALRAYINTPNARKVASSCGTPFPNC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10029131 [exp]	0	1
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10013030 [exp]	1.0	0.9804
AT1G01470		LSR3, LEA14	LIGHT STRESS-REGULATED 3, LATE...		Lus10007905 [exp]	1.7	0.9496
AT4G14540	CCAAT	NF-YB3	"nuclear factor Y, subunit B3"...		Lus10016616 [exp]	2.0	0.9286
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Lus10007640 [exp]	3.5	0.9522
AT1G56430		ATNAS4	ARABIDOPSIS THALIANA NICOTIANA...		Lus10020696 [exp]	5.8	0.9024
AT1G28680			HXXXD-type acyl-transferase fa...		Lus10015303 [exp]	6.3	0.9183
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Lus10040428 [exp]	8.5	0.9237
AT2G41905			unknown protein		Lus10040498 [exp]	8.8	0.9092
AT1G47410			unknown protein		Lus10009767 [exp]	12.6	0.9179
AT1G01360		PYL9, RCAR1	PYRABACTIN RESISTANCE 1-LIKE 9...		Lus10040916 [exp]	13.0	0.8863

Compare expression of checked genes

Lus10029131 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.