Lus10029137 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23440 298 / 2e-103 Peptidase C15, pyroglutamyl peptidase I-like (.1.2)
AT1G56700 270 / 1e-92 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013026 410 / 1e-147 AT1G23440 309 / 6e-108 Peptidase C15, pyroglutamyl peptidase I-like (.1.2)
Lus10001521 251 / 8e-84 AT1G56700 312 / 2e-107 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
Lus10031438 171 / 2e-50 AT1G09390 406 / 4e-139 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G005800 273 / 8e-94 AT1G56700 335 / 5e-118 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
Potri.013G005100 271 / 1e-92 AT1G56700 344 / 1e-121 Peptidase C15, pyroglutamyl peptidase I-like (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0379 PgaPase PF01470 Peptidase_C15 Pyroglutamyl peptidase
Representative CDS sequence
>Lus10029137 pacid=23151724 polypeptide=Lus10029137 locus=Lus10029137.g ID=Lus10029137.BGIv1.0 annot-version=v1.0
ATGGGATCAGAAGCACCAAAGTCTGTAGTCGTCCACGTAACCGGATTCAAGAAATTCCAAGGTGTGACCCAGAATCCTACCGAGACTATAGTGAACAGGC
TCAAGGATTACGTCGCTAAGCGAGGATTGCCTGCTGGCGTTACGGTAGGCAGTTGCACTGTCCTCGAAACGGCTGGAGATGGAGCTCTTACGATGCTCTA
CAACACTCTCGAATCAAACACCACCGCCACAACGAATGCAGAGAAGAACGAGCAAGTTGTCTGGCTTCACTTGGGGGTGAACAGCGGGGCAGTGAAGTTC
GCCATTGAACGATGTGCAGTAAATGAAGCCACTTTTCGATGCCCCGATGAAATGGGATGGCAACCTCAGAACCATCCTATAATCTCGGAAGATGGAGAAA
TCACTTGTCTAAGACAGACGTGGTGCCCGGTCGATGGAATCTTCATATACTTGAGGAAGAAAGGCTTCGATGCTACAATATCAGACGATGCTGGACGCTA
TGTCTGCAACTATGTATACTATCATTCCCTCAAGTTCGCCCAGCAGAAGGGCCAGAAGTCTCTATTCGTTCATGTCCCACTCTTCTCGAGAATCGACGAG
GAGACCCAGATGGAGTTTGTGGCGACTGTTGTAGAAGCTATAGGATCAACCTGTTGA
AA sequence
>Lus10029137 pacid=23151724 polypeptide=Lus10029137 locus=Lus10029137.g ID=Lus10029137.BGIv1.0 annot-version=v1.0
MGSEAPKSVVVHVTGFKKFQGVTQNPTETIVNRLKDYVAKRGLPAGVTVGSCTVLETAGDGALTMLYNTLESNTTATTNAEKNEQVVWLHLGVNSGAVKF
AIERCAVNEATFRCPDEMGWQPQNHPIISEDGEITCLRQTWCPVDGIFIYLRKKGFDATISDDAGRYVCNYVYYHSLKFAQQKGQKSLFVHVPLFSRIDE
ETQMEFVATVVEAIGSTC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23440 Peptidase C15, pyroglutamyl pe... Lus10029137 0 1
AT1G11380 PLAC8 family protein (.1) Lus10002586 1.4 0.9626
AT1G27450 APRT, ATAPT1, A... ARABIDOPSIS THALIANA ADENINE P... Lus10007757 2.4 0.9456
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10037268 3.2 0.9539
AT4G07390 Mannose-P-dolichol utilization... Lus10017025 5.0 0.9179
AT5G37480 unknown protein Lus10001333 6.2 0.9132
AT1G50740 Transmembrane proteins 14C (.1... Lus10008541 6.7 0.9322
AT5G37480 unknown protein Lus10013637 6.9 0.9247
AT3G18620 DHHC-type zinc finger family p... Lus10040971 8.7 0.9217
AT2G37740 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) Lus10024362 8.7 0.9426
AT1G10430 PP2A-2 protein phosphatase 2A-2 (.1) Lus10013287 9.9 0.9355

Lus10029137 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.