Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12050 96 / 4e-26 Aha1 domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021072 [exp] 105 / 2e-29 AT3G12050 523 / 0.0 Aha1 domain-containing protein (.1.2) Lus10013024 [exp] 105 / 2e-29 AT2G18770 223 / 2e-71 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G194400 [exp] 90 / 2e-23 AT3G12050 473 / 3e-168 Aha1 domain-containing protein (.1.2) Potri.016G060100 [exp] 89 / 5e-23 AT3G12050 480 / 5e-171 Aha1 domain-containing protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10029141 pacid=23151741 polypeptide=Lus10029141 locus=Lus10029141.g ID=Lus10029141.BGIv1.0 annot-version=v1.0 ATGGAAGAACCTGAAGCTGGCGCGACGGTGGTGAAGCTGACTCACAGTGATATACCAGAAGATGATAGATATGGAAATGCAATTGTGGTGGAGAACACTG AGAGGGGATGGAGGGATCTCATCTTCCACAAGATAAGAGCAGTTTTTGGGTTTGGCATGAAGAATGAATGA
AA sequence Show only first row Show all	>Lus10029141 pacid=23151741 polypeptide=Lus10029141 locus=Lus10029141.g ID=Lus10029141.BGIv1.0 annot-version=v1.0 MEEPEAGATVVKLTHSDIPEDDRYGNAIVVENTERGWRDLIFHKIRAVFGFGMKNE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12050			Aha1 domain-containing protein...		Lus10029141 [exp]	0	1
AT5G46680			Pentatricopeptide repeat (PPR-...		Lus10027024 [exp]	6.0	0.7933
AT1G05670			Pentatricopeptide repeat (PPR-...		Lus10027025 [exp]	7.4	0.7838
					Lus10009962 [exp]	8.8	0.7745
AT2G35510		SRO1	similar to RCD one 1 (.1)		Lus10035390 [exp]	11.3	0.7933
AT5G17690		AtLHP1, LHP1, T...	TERMINAL FLOWER 2, LIKE HETERO...		Lus10001338 [exp]	14.5	0.7645
AT4G36980			unknown protein		Lus10019346 [exp]	18.5	0.7669
AT3G51130			unknown protein		Lus10014270 [exp]	19.4	0.7893
AT4G36210			Protein of unknown function (D...		Lus10028363 [exp]	19.6	0.7734
AT3G03800		ATSYP131, SYP13...	syntaxin of plants 131 (.1)		Lus10015121 [exp]	24.7	0.7636
AT5G08710		RUG1	RCC1/UVR8/GEF-like 1, Regulato...		Lus10035957 [exp]	29.9	0.7581

Compare expression of checked genes

Lus10029141 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.