Lus10029155 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23750 206 / 9e-70 Nucleic acid-binding, OB-fold-like protein (.1)
AT1G10590 202 / 3e-68 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
AT2G33845 182 / 8e-60 Nucleic acid-binding, OB-fold-like protein (.1)
AT4G28440 165 / 2e-53 Nucleic acid-binding, OB-fold-like protein (.1)
AT1G03810 159 / 3e-51 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013010 273 / 3e-96 AT1G23750 206 / 1e-69 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10030617 209 / 6e-71 AT1G23750 229 / 7e-79 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10030871 207 / 5e-70 AT1G23750 226 / 2e-77 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10015411 178 / 3e-58 AT2G33845 186 / 4e-61 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10013989 175 / 4e-57 AT4G28440 186 / 3e-61 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10002172 157 / 2e-50 AT2G33845 189 / 1e-62 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10039889 152 / 3e-48 AT2G33845 185 / 1e-60 Nucleic acid-binding, OB-fold-like protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G041000 218 / 2e-74 AT1G23750 234 / 1e-80 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.008G189900 213 / 1e-72 AT1G23750 239 / 9e-83 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.011G114800 187 / 7e-62 AT2G33845 214 / 3e-72 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.001G396100 186 / 2e-61 AT1G23750 194 / 5e-65 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.007G137600 179 / 3e-59 AT4G28440 193 / 2e-64 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.017G014400 174 / 6e-57 AT4G28440 194 / 9e-65 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Representative CDS sequence
>Lus10029155 pacid=23151757 polypeptide=Lus10029155 locus=Lus10029155.g ID=Lus10029155.BGIv1.0 annot-version=v1.0
ATGGCAGAGGGAAAACAAGAATTGAGGAAGCCTGTATTCACCAAGGTCGAGCAACTTCGTCCAGGGACTACTGGGCACACCTTGACAGTAAAGGTTTTAA
GCACAAAAATGGTGAAGGTGGGTCGTTCAGATGGTCCTCAAATGCGCCAAAATCGGCTTGCAGAGTGTTTGGTTGGTGATGAGACTGGGATTATTATATT
CACCGCAAGGTTTGATCAAGTGGACTTGATGAAGGAAGGAACAACGGTGATCCTCCGCAATGCGAAAATTGACATGTACAAAGGATCGATGAGGCTTGCT
GTGGACAAGTGGGGACGTATTGAAGAAGTGTCCGAGCCTGAAAGCATCAAAGTTAAGGAAGACAACAACCTCTCGCTCATCGAATATGAGGTCATCACCA
TTGTAGAAGACTGA
AA sequence
>Lus10029155 pacid=23151757 polypeptide=Lus10029155 locus=Lus10029155.g ID=Lus10029155.BGIv1.0 annot-version=v1.0
MAEGKQELRKPVFTKVEQLRPGTTGHTLTVKVLSTKMVKVGRSDGPQMRQNRLAECLVGDETGIIIFTARFDQVDLMKEGTTVILRNAKIDMYKGSMRLA
VDKWGRIEEVSEPESIKVKEDNNLSLIEYEVITIVED

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23750 Nucleic acid-binding, OB-fold-... Lus10029155 0 1
AT4G20150 unknown protein Lus10038391 1.0 0.8879
AT2G17570 Undecaprenyl pyrophosphate syn... Lus10002788 5.2 0.8549
AT2G36130 Cyclophilin-like peptidyl-prol... Lus10017010 5.3 0.8793
AT5G03345 unknown protein Lus10013817 6.3 0.8649
AT5G51970 GroES-like zinc-binding alcoho... Lus10027410 8.7 0.8241
AT5G49210 unknown protein Lus10036792 8.9 0.8301
AT5G49210 unknown protein Lus10037138 9.2 0.8619
AT3G45020 Ribosomal L18p/L5e family prot... Lus10016132 9.5 0.8523
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10003170 10.7 0.8734
AT1G07170 PHF5-like protein (.1.2.3) Lus10040654 12.5 0.8470

Lus10029155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.