Lus10029164 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10029164 pacid=23151664 polypeptide=Lus10029164 locus=Lus10029164.g ID=Lus10029164.BGIv1.0 annot-version=v1.0
ATGTTTTACGCATGGCATACACGCCCGATTCTTTCTCCGCCGCCGTCGATAGCGCCTCCTCCGCTCAGCTCTACCACCTCACTTGGAAGAGGAGATATTA
ACAAGCTCCGATTTGACGAGGGACCTGGAAATCGAAGGTTTGAAAGCGACGGAGGTGGTGACATCAAGCTTTGCCGAGTTAGGGGGTTAGAAAGTGGAGC
TCAGATCCGCCGCCGAGGAGATGGGAGTACGAGTTCCCGACGATAA
AA sequence
>Lus10029164 pacid=23151664 polypeptide=Lus10029164 locus=Lus10029164.g ID=Lus10029164.BGIv1.0 annot-version=v1.0
MFYAWHTRPILSPPPSIAPPPLSSTTSLGRGDINKLRFDEGPGNRRFESDGGGDIKLCRVRGLESGAQIRRRGDGSTSSRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10029164 0 1
AT1G30920 F-box family protein (.1) Lus10006734 4.0 0.8821
AT3G57030 Calcium-dependent phosphotries... Lus10009651 5.1 0.8262
AT3G18170 Glycosyltransferase family 61 ... Lus10032454 6.0 0.8650
Lus10033017 6.8 0.6106
AT2G24370 Protein kinase protein with ad... Lus10027593 7.3 0.8650
Lus10004437 8.5 0.8650
AT4G37360 CYP81D2 "cytochrome P450, family 81, s... Lus10018719 8.9 0.7591
AT5G02910 F-box/RNI-like superfamily pro... Lus10000727 9.5 0.8650
Lus10039674 10.4 0.8650
Lus10021739 11.2 0.8650

Lus10029164 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.