Lus10029165 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10550 386 / 1e-135 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT2G01850 263 / 1e-86 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT1G14720 261 / 4e-86 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT1G32170 229 / 2e-73 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT4G18990 223 / 7e-71 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT3G44990 202 / 2e-63 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT4G13090 197 / 1e-61 XTH2 xyloglucan endotransglucosylase/hydrolase 2 (.1)
AT2G36870 196 / 7e-61 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT3G25050 194 / 3e-60 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT5G65730 193 / 6e-60 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013000 549 / 0 AT1G10550 397 / 9e-140 xyloglucan:xyloglucosyl transferase 33 (.1)
Lus10029000 261 / 1e-85 AT1G14720 457 / 1e-162 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Lus10013240 252 / 2e-82 AT2G01850 456 / 2e-162 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Lus10030760 251 / 5e-82 AT1G14720 456 / 3e-162 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Lus10010427 231 / 1e-73 AT1G32170 462 / 5e-164 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Lus10026535 209 / 4e-66 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013822 208 / 1e-65 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10041341 204 / 4e-64 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10016144 204 / 7e-64 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G115000 402 / 1e-141 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1)
Potri.008G138400 267 / 3e-88 AT1G14720 467 / 2e-166 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.010G102300 266 / 1e-87 AT1G14720 470 / 7e-168 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.001G136100 244 / 5e-79 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.003G097300 243 / 1e-78 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.009G163850 231 / 9e-75 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.009G006600 202 / 2e-63 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.016G098600 199 / 3e-62 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.006G122900 197 / 1e-61 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.002G244200 192 / 1e-59 AT4G13090 321 / 3e-110 xyloglucan endotransglucosylase/hydrolase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10029165 pacid=23151654 polypeptide=Lus10029165 locus=Lus10029165.g ID=Lus10029165.BGIv1.0 annot-version=v1.0
ATGCTCTGCCCACTCTTCCCACTACTGTATCTCCTGCTTCTTACAGCATCAGGAGTTTCTTCACGCAACACCCCTTATACCCCTCCAAACGTCAAACGTT
TGACTGATCTCTTTGGTCCCTTGACCATTAACCAAGGTTTCAACACTTACTATGGCGGCCAACATGTTAAGCAGTTCAACAATGGGTCCTTTGCCACTCT
TTCTCTGGACAAGGCTTCAGGAGCTGGGTTGGCATCGACGAACAAATACTTATATGGGTTCTTCAGTGCTGCAATAAAGTTGCCTTCTGGTCTGTCACCT
GGAGTTGTGGTAGCCTTCTATTTGTCTAATGCAGAAACTTACCCTCACAACCACGACGAGATTGATTTCGAGATACTTGGACACGACAGGAAGAACGACT
GGAACTTGCAGACGAATGTGTACGCAAATGGGAGTGTGAGCACTGGCAGGGAAGAGAAGTTTAACTTCTGGTTTGACCCTACTCAGGACTACCACAACTA
CAGCATCATTTGGAACAGCCACCATATAGTGTTTCTGGTGGATAGTGTACCAGTGAGGGAGTACAAGTACAACCCATCAGCATACCCAATGAAACCAATG
AGTGTTATTGCAACAATATGGGATGGTTCAGAATGGGCAACAAATGGAGGGAAGTACCCAGTAAACTACAAGTATGCACCATTTGTGGTCTCAATTGGAG
ATGCTGAATTGGCTGGCTGCATTCCAAATCCAGCTTCTTCTGGTTCTTGCTCCAAGACTAGCAGCAGTGGTAGTCCTTCAAGCTTGGATCCAGTGGATGG
ATCAGAATTTGCTACTTTGTCACAGGAACAAAATATCGCTATGGACTGGGCAAGGAGGAAGCTCATGTTCTACTCTTACTGTAGTGATAAACCTAGGTAC
AAGGTCCCACCATCTGAATGTAAATGA
AA sequence
>Lus10029165 pacid=23151654 polypeptide=Lus10029165 locus=Lus10029165.g ID=Lus10029165.BGIv1.0 annot-version=v1.0
MLCPLFPLLYLLLLTASGVSSRNTPYTPPNVKRLTDLFGPLTINQGFNTYYGGQHVKQFNNGSFATLSLDKASGAGLASTNKYLYGFFSAAIKLPSGLSP
GVVVAFYLSNAETYPHNHDEIDFEILGHDRKNDWNLQTNVYANGSVSTGREEKFNFWFDPTQDYHNYSIIWNSHHIVFLVDSVPVREYKYNPSAYPMKPM
SVIATIWDGSEWATNGGKYPVNYKYAPFVVSIGDAELAGCIPNPASSGSCSKTSSSGSPSSLDPVDGSEFATLSQEQNIAMDWARRKLMFYSYCSDKPRY
KVPPSECK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G10550 XTH33, XET xyloglucan:xyloglucosyl transf... Lus10029165 0 1
AT3G03490 AtPEX19-1, PEX1... peroxin 19-1 (.1) Lus10010463 12.0 0.7571
AT3G05010 Protein of unknown function, t... Lus10040523 24.3 0.6730
AT3G19320 Leucine-rich repeat (LRR) fami... Lus10027878 25.6 0.7572
AT1G31770 ABCG14 ATP-binding cassette G14, ATP-... Lus10035692 25.9 0.7030
AT2G38310 RCAR10, PYL4 regulatory components of ABA r... Lus10002861 33.2 0.7437
AT1G74940 Protein of unknown function (D... Lus10027642 35.6 0.7423
AT5G11900 Translation initiation factor ... Lus10013512 39.2 0.6990
AT5G19740 Peptidase M28 family protein (... Lus10011133 47.4 0.7336
AT4G31990 AAT3, ATAAT1, A... ASPARTATE AMINOTRANSFERASE DEF... Lus10001938 51.0 0.7279
AT3G15140 Polynucleotidyl transferase, r... Lus10005381 62.8 0.7262

Lus10029165 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.